Entry information : GzNOx01
Entry ID 6666
Creation 2009-04-03 (Christophe Dunand)
Last sequence changes 2009-04-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: GzNOx01
Name GzNOx01
Class Ancestral NADPH oxidase    [Orthogroup: NOx002]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GzNOx01
start..stop
S start..stop
EfeNOx 1023 0 1..557 1..557
NcNOx01 986 0 5..557 1..553
CpurNOx01 961 0 1..557 1..557
MgrNOx01 951 0 9..557 5..553
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2392114..2392226 113 N° 2 2392282..2393765 1484 N° 3 2393823..2393899 77  
join(2392114..2392226,2392282..2393765,2393823..2393899)


exon

Literature and cross-references GzNOx01
Literature Hatsch,D., Phalip,V., Petkovski,E. and Jeltsch,J.-M. The transcriptom of Fusarium graminearum grown on plant cell walls reveals several families of pathology-related genes.
DNA ref. JGI genome:   Supercontig_3.1 (2392114..2393899)
EST ref. GenBank:   CV828010.1 [3' end]
Protein sequence: GzNOx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   557
PWM (Da):   %s   64000.66 Transmb domain:   %s   i20-42o57-79i105-127o142-164i177-199o
PI (pH):   %s   8.52
Sequence 598
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSQLGFVELIKKQFVPGKLLYHFLFWTFHWGIFAYGWWKQAVDPRLAGLNTLKFSVWISRGAGLVLSVDCMLILLPVCRTVMRWVRPKIRFLPLDENLWMHRQLAYSMLLFTCLHTGAHYVNFYNVEITQIRPVTALQIHYAQPGGITGHIMLLCMLLMFTSAHARIRQQSFETFWYTHHLFIPFFLGLYTHTVGCFVRDTPEAFSPFAGDEFWEHCIGYLGWRWELWTGGAYLLERLWREVRARRSTKITRVVRHPYDVVEIQFNKPSFKYKAGQWLFLQVPSLSKYQWHPFTITSCPFDPYVSVHVRQVGDFTRELGDALGAGAAQAKLYDDVDPMGMYEVALQNGDQMPALRIDGPYGAPAEDVFENEIAVLIGTGIGVTPWAAILKNIWHLRNSPNPPRRLRRVEFIWVCKDTGSFEWFQTLLSSLEEQSNEAARMPGSTGVEFLKIHTYLTQKLDIDTAQNIVLNSVGSQMDPLTELQSRTNFGRPDFPRLFTTMRNGILDRTYLNGLESHIRTTVGVYFCGPSAAARDIKLACKAATVPDVDFRFWKEHF

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 2 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGTTCGCAACTCGGGTTCGTCGAATTAATAAAGAAGCAGTTTGTACCTGGCAAACTGCTCTATCACTTTCTTTTCTGGACGTTTCACTGGGGTATCTTTGCCTATGGATGGTGAGTTG
AAAACAATCCTTCGAAACCGTCTCATCACTAACCAGCTTTTATCAAGGTGGAAGCAAGCTGTAGACCCTAGACTCGCAGGTCTTAACACACTCAAATTCTCAGTATGGATCTCACGAGGT
GCTGGTTTAGTTCTCAGTGTCGACTGCATGCTTATTCTCCTCCCCGTATGCCGAACCGTTATGCGATGGGTTCGACCCAAGATTCGCTTCCTCCCTCTCGATGAGAACCTGTGGATGCAC
CGCCAGCTCGCCTATTCCATGCTTCTCTTCACCTGCCTTCACACAGGCGCTCACTACGTCAACTTTTACAACGTCGAAATCACTCAGATCCGACCCGTTACGGCTCTTCAGATTCACTAT
GCTCAGCCTGGTGGTATCACTGGTCACATCATGCTTCTCTGCATGCTGCTCATGTTTACCAGCGCCCACGCTCGTATCCGTCAACAATCGTTTGAGACGTTTTGGTACACTCACCATCTC
TTCATCCCTTTCTTCCTCGGCCTCTACACCCACACAGTGGGATGTTTCGTGCGTGACACTCCCGAGGCTTTCTCACCATTCGCCGGCGACGAGTTCTGGGAGCACTGCATTGGTTACCTC
GGATGGCGATGGGAGCTCTGGACTGGTGGCGCCTACCTCCTCGAGCGTCTCTGGCGTGAGGTTCGCGCTCGTCGATCTACAAAGATTACCCGAGTCGTCCGTCACCCCTACGATGTGGTA
GAGATTCAGTTCAACAAGCCATCTTTCAAGTACAAGGCTGGTCAGTGGCTCTTCCTCCAGGTACCTTCGCTCTCCAAGTACCAGTGGCATCCCTTTACCATCACTTCATGCCCCTTCGAC
CCTTATGTGTCAGTTCACGTTCGCCAGGTTGGTGACTTCACCCGAGAGCTGGGTGATGCCCTTGGTGCCGGTGCTGCTCAGGCCAAGCTTTACGATGATGTTGACCCCATGGGAATGTAC
GAGGTTGCTCTTCAGAACGGTGACCAGATGCCCGCTCTTCGAATTGATGGACCTTACGGTGCGCCTGCCGAGGATGTTTTCGAGAACGAAATCGCTGTTCTTATCGGTACTGGTATTGGT
GTCACTCCTTGGGCTGCTATCCTCAAGAACATCTGGCATCTCCGCAACTCTCCCAACCCTCCCCGCCGTCTTCGCCGAGTCGAGTTCATCTGGGTTTGCAAGGATACTGGTTCATTCGAG
TGGTTCCAGACTCTGCTGTCATCTCTTGAGGAGCAGTCCAACGAAGCAGCACGTATGCCTGGCAGCACAGGAGTCGAGTTCCTCAAGATCCACACCTATCTCACACAGAAGCTGGATATC
GACACTGCTCAGAACATTGTCCTCAACAGTGTCGGCTCTCAGATGGATCCCCTCACAGAACTACAATCACGAACCAACTTTGGTCGACCTGATTTCCCCCGCCTATTCACAACCATGCGA
AACGGTATCTTGGACCGCACATACCTTAACGGTCTAGAGTCACACATTCGCACGACAGTTGGTGTTTATTTCTGTGGTCCTTCAGCTGCTG
GTAAGTTACATTCTAAACCCATGCTATTC
TAAAAATGCATGCTAACAAAATCTTCAGCTCGTGATATTAAACTTGCATGTAAAGCAGCAACCGTGCCCGACGTGGATTTCCGTTTCTGGAAGGAGCACTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGTTCGCAACTCGGGTTCGTCGAATTAATAAAGAAGCAGTTTGTACCTGGCAAACTGCTCTATCACTTTCTTTTCTGGACGTTTCACTGGGGTATCTTTGCCTATGGATGGTGGAAGC
AAGCTGTAGACCCTAGACTCGCAGGTCTTAACACACTCAAATTCTCAGTATGGATCTCACGAGGTGCTGGTTTAGTTCTCAGTGTCGACTGCATGCTTATTCTCCTCCCCGTATGCCGAA
CCGTTATGCGATGGGTTCGACCCAAGATTCGCTTCCTCCCTCTCGATGAGAACCTGTGGATGCACCGCCAGCTCGCCTATTCCATGCTTCTCTTCACCTGCCTTCACACAGGCGCTCACT
ACGTCAACTTTTACAACGTCGAAATCACTCAGATCCGACCCGTTACGGCTCTTCAGATTCACTATGCTCAGCCTGGTGGTATCACTGGTCACATCATGCTTCTCTGCATGCTGCTCATGT
TTACCAGCGCCCACGCTCGTATCCGTCAACAATCGTTTGAGACGTTTTGGTACACTCACCATCTCTTCATCCCTTTCTTCCTCGGCCTCTACACCCACACAGTGGGATGTTTCGTGCGTG
ACACTCCCGAGGCTTTCTCACCATTCGCCGGCGACGAGTTCTGGGAGCACTGCATTGGTTACCTCGGATGGCGATGGGAGCTCTGGACTGGTGGCGCCTACCTCCTCGAGCGTCTCTGGC
GTGAGGTTCGCGCTCGTCGATCTACAAAGATTACCCGAGTCGTCCGTCACCCCTACGATGTGGTAGAGATTCAGTTCAACAAGCCATCTTTCAAGTACAAGGCTGGTCAGTGGCTCTTCC
TCCAGGTACCTTCGCTCTCCAAGTACCAGTGGCATCCCTTTACCATCACTTCATGCCCCTTCGACCCTTATGTGTCAGTTCACGTTCGCCAGGTTGGTGACTTCACCCGAGAGCTGGGTG
ATGCCCTTGGTGCCGGTGCTGCTCAGGCCAAGCTTTACGATGATGTTGACCCCATGGGAATGTACGAGGTTGCTCTTCAGAACGGTGACCAGATGCCCGCTCTTCGAATTGATGGACCTT
ACGGTGCGCCTGCCGAGGATGTTTTCGAGAACGAAATCGCTGTTCTTATCGGTACTGGTATTGGTGTCACTCCTTGGGCTGCTATCCTCAAGAACATCTGGCATCTCCGCAACTCTCCCA
ACCCTCCCCGCCGTCTTCGCCGAGTCGAGTTCATCTGGGTTTGCAAGGATACTGGTTCATTCGAGTGGTTCCAGACTCTGCTGTCATCTCTTGAGGAGCAGTCCAACGAAGCAGCACGTA
TGCCTGGCAGCACAGGAGTCGAGTTCCTCAAGATCCACACCTATCTCACACAGAAGCTGGATATCGACACTGCTCAGAACATTGTCCTCAACAGTGTCGGCTCTCAGATGGATCCCCTCA
CAGAACTACAATCACGAACCAACTTTGGTCGACCTGATTTCCCCCGCCTATTCACAACCATGCGAAACGGTATCTTGGACCGCACATACCTTAACGGTCTAGAGTCACACATTCGCACGA
CAGTTGGTGTTTATTTCTGTGGTCCTTCAGCTGCTG
CTCGTGATATTAAACTTGCATGTAAAGCAGCAACCGTGCCCGACGTGGATTTCCGTTTCTGGAAGGAGCACTTCTAA

Retrieve as FASTA