Entry information : GzNOx03
Entry ID 6667
Creation 2009-04-03 (Christophe Dunand)
Last sequence changes 2012-04-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2009-04-03 (Christophe Dunand)
Peroxidase information: GzNOx03
Name GzNOx03
Class Ancestral NADPH oxidase    [Orthogroup: NOx004]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GzNOx03
start..stop
S start..stop
MgrNOx03 905 0 24..750 100..848
VvRboh07 176 3.93e-46 158..744 363..913
OsRboh07 172 6.08e-45 167..744 448..1003
DtriRboh03 172 7.46e-45 30..744 271..951
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6667' 'join(138704..138749,138895..141104)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 138704..138749 44 N° 2 138895..141104 2208  
join(138704..138749,138895..141104)


exon

Literature and cross-references GzNOx03
DNA ref. JGI genome:   Supercontig_3.8 (138704..141104)
Protein sequence: GzNOx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   751
PWM (Da):   %s   86334.42 Transmb domain:   %s   i143-165o185-207i234-256o289-311i323-345o
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLTYDDFWACRMLRLYHPVRSSQNVEFLTDKEISDFLDDLDHDNDGHINYEEVERKLDQEHANLVPKPSAHHVISTDHSDDDRTRHAFLRRMMGDSGVDQIPRDEFAKMVKEWKIPSLKQ
AKKEEEEDKSYIKRLPGWRRIRSYWAVHGPEIVFLGVVISMQLAFGIWQLVKYQTTPGYRAAFGWGVVMAKTCAGALYPTFFFLILSMSRYFSTWLRRSYHISRFFNWDLSQEFHIRISC
VAILLATLHAIGHLTGSFVHGSDPANEDAVAEALGPDKVPRPYIDYVRSLPGFTGITALGLFWILCLLSIPQVRRWNYEVFQLGHLLMFPIIGLMMAHGTAALLQWPMFGYFLAFPTLLV
LVERTVRVGLGFHRIKATMKVLDKETVEVTAIIPSERLWKYKAGQYIFLQVPKISFFQWHPFTVSFCRGNKMMLHIKTDGNWTAKLRELGGDSGESEIEVGINGPFGAPAQRFYDFNHSI
IIGAGIGVTPFSGILADLQYNDDLDHGGPNHEVDHHRHDSEATAIPQAARRSDSSSSDEATTSDNVPETPTRQGSVGPDLINKEKQPQADKAGSFAEDYRRVDFHWMVRERNYLLWLSDL
LNDVSMSQDWHREHEDKPHLDIRINTHVTAKQKKISTHVYRWLLEMHRTDEHPASPLTGLLNPTHFGRPDFDLILDEHYEEMLKFRASKRTSTRNKEDENYEEDEELKVGVFYCGAPVVG
EILADKCRELTLRGWQDGSKLEYHFMIEVFG

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 1 intron). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGACGTACGACGATTTCTGGGCATGCAGGATGTTGAGACTATATGTAAATTTCCGTCATCCCCTTGTAGGCGTGCAATTCTTTTTCCAACATCTGCTGTCTCTCCCCAGTAATCTC
AATCAGACAACTTCAACCGTAGTCTGTCCTGCAATGGCTGCAGCCCATCGCCATCGCAAATCCGTTGCTGCAGATCACCCTGTCCGTTCCTCCCAAAACGTCGAATTCCTCACCGATAAA
GAGATCTCCGACTTCCTCGACGACCTCGACCACGATAACGATGGACACATAAATTATGAAGAAGTCGAGCGAAAACTCGACCAAGAACATGCCAATCTAGTTCCCAAGCCAAGTGCCCAC
CATGTCATCAGTACAGACCACAGCGACGATGACCGCACTCGCCATGCCTTCCTGCGAAGGATGATGGGTGATTCAGGTGTGGATCAAATCCCTCGAGACGAGTTTGCCAAGATGGTCAAG
GAGTGGAAGATTCCTTCACTCAAACAGGCAAAGAAGGAAGAGGAGGAGGATAAGAGTTACATCAAGAGACTGCCAGGTTGGAGACGAATCCGGTCGTACTGGGCTGTTCACGGACCTGAG
ATTGTGTTTCTTGGTGTTGTCATCAGCATGCAGTTGGCCTTTGGAATTTGGCAGCTTGTCAAGTACCAGACAACGCCTGGTTACCGTGCGGCGTTTGGCTGGGGCGTCGTCATGGCCAAG
ACCTGTGCCGGGGCTTTGTATCCGACATTCTTCTTTCTGATTCTCAGCATGTCGCGATACTTTTCTACGTGGCTGCGTAGGTCGTACCATATTTCGCGCTTCTTTAATTGGGATCTTTCG
CAGGAGTTCCATATTAGGATATCTTGCGTTGCTATCCTGCTGGCGACACTACATGCTATCGGACATTTGACTGGATCATTTGTTCATGGCAGCGATCCCGCGAATGAGGATGCGGTGGCA
GAGGCACTCGGTCCTGATAAGGTTCCTCGCCCTTACATCGACTATGTTCGATCTCTTCCTGGTTTTACCGGCATAACTGCTCTTGGTCTCTTTTGGATCCTCTGTCTGCTTAGTATTCCA
CAAGTTCGAAGATGGAACTATGAGGTCTTCCAACTTGGTCATCTACTCATGTTTCCCATCATTGGTCTCATGATGGCTCATGGTACAGCCGCGCTGCTTCAATGGCCCATGTTCGGTTAC
TTCCTGGCCTTTCCCACACTTTTGGTCCTTGTAGAACGCACCGTCCGTGTTGGTCTCGGATTCCACCGCATCAAAGCTACCATGAAGGTATTGGACAAAGAGACTGTCGAGGTCACGGCA
ATCATCCCTAGTGAACGTCTCTGGAAGTACAAGGCTGGCCAGTACATCTTCCTGCAAGTTCCCAAGATCAGCTTCTTCCAATGGCATCCATTCACTGTGTCTTTCTGTCGAGGCAACAAG
ATGATGCTGCACATCAAGACTGACGGCAACTGGACTGCTAAGCTTCGTGAGCTTGGAGGTGATTCTGGAGAGTCTGAGATCGAAGTTGGCATCAACGGTCCCTTTGGTGCACCTGCTCAA
CGGTTCTACGACTTCAACCATTCCATCATCATCGGAGCTGGTATCGGCGTCACGCCATTTTCTGGTATCCTTGCCGATCTACAGTACAACGACGATCTCGACCACGGCGGCCCAAACCAT
GAAGTCGATCATCACCGTCACGACTCTGAAGCAACTGCTATCCCACAAGCTGCTCGTCGATCGGACTCAAGTAGTAGCGATGAAGCGACCACCAGCGATAACGTACCCGAAACACCCACG
CGACAAGGAAGTGTCGGCCCCGATCTCATCAACAAGGAGAAACAGCCCCAAGCCGATAAAGCAGGCAGCTTTGCAGAAGACTACCGAAGAGTGGATTTTCACTGGATGGTCCGTGAACGA
AATTACCTCCTCTGGCTGTCCGACCTTCTCAACGATGTATCCATGAGTCAAGACTGGCACCGCGAGCATGAAGACAAACCTCATCTCGACATCCGCATCAACACACACGTAACAGCCAAA
CAGAAGAAGATATCGACTCACGTGTACCGTTGGCTTTTGGAGATGCACCGCACAGATGAACATCCTGCATCGCCGCTTACTGGTCTTCTTAATCCCACGCACTTTGGCCGGCCCGACTTT
GATCTTATCCTGGATGAGCATTATGAAGAGATGCTCAAGTTTCGGGCGAGTAAGAGGACAAGTACAAGAAATAAAGAGGACGAGAATTATGAGGAAGATGAAGAGCTCAAGGTTGGCGTG
TTTTACTGTGGTGCGCCTGTTGTGGGTGAGATTCTGGCGGATAAGTGTCGTGAGCTCACGTTGCGGGGGTGGCAGGATGGAAGTAAGTTGGAGTATCACTTTATGATTGAGGTTTTTGGA
TGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGACGTACGACGATTTCTGGGCATGCAGGATGTTGAGACTATATCACCCTGTCCGTTCCTCCCAAAACGTCGAATTCCTCACCGATAAAGAGATCTCCGACTTCCTCGACGACCTC
GACCACGATAACGATGGACACATAAATTATGAAGAAGTCGAGCGAAAACTCGACCAAGAACATGCCAATCTAGTTCCCAAGCCAAGTGCCCACCATGTCATCAGTACAGACCACAGCGAC
GATGACCGCACTCGCCATGCCTTCCTGCGAAGGATGATGGGTGATTCAGGTGTGGATCAAATCCCTCGAGACGAGTTTGCCAAGATGGTCAAGGAGTGGAAGATTCCTTCACTCAAACAG
GCAAAGAAGGAAGAGGAGGAGGATAAGAGTTACATCAAGAGACTGCCAGGTTGGAGACGAATCCGGTCGTACTGGGCTGTTCACGGACCTGAGATTGTGTTTCTTGGTGTTGTCATCAGC
ATGCAGTTGGCCTTTGGAATTTGGCAGCTTGTCAAGTACCAGACAACGCCTGGTTACCGTGCGGCGTTTGGCTGGGGCGTCGTCATGGCCAAGACCTGTGCCGGGGCTTTGTATCCGACA
TTCTTCTTTCTGATTCTCAGCATGTCGCGATACTTTTCTACGTGGCTGCGTAGGTCGTACCATATTTCGCGCTTCTTTAATTGGGATCTTTCGCAGGAGTTCCATATTAGGATATCTTGC
GTTGCTATCCTGCTGGCGACACTACATGCTATCGGACATTTGACTGGATCATTTGTTCATGGCAGCGATCCCGCGAATGAGGATGCGGTGGCAGAGGCACTCGGTCCTGATAAGGTTCCT
CGCCCTTACATCGACTATGTTCGATCTCTTCCTGGTTTTACCGGCATAACTGCTCTTGGTCTCTTTTGGATCCTCTGTCTGCTTAGTATTCCACAAGTTCGAAGATGGAACTATGAGGTC
TTCCAACTTGGTCATCTACTCATGTTTCCCATCATTGGTCTCATGATGGCTCATGGTACAGCCGCGCTGCTTCAATGGCCCATGTTCGGTTACTTCCTGGCCTTTCCCACACTTTTGGTC
CTTGTAGAACGCACCGTCCGTGTTGGTCTCGGATTCCACCGCATCAAAGCTACCATGAAGGTATTGGACAAAGAGACTGTCGAGGTCACGGCAATCATCCCTAGTGAACGTCTCTGGAAG
TACAAGGCTGGCCAGTACATCTTCCTGCAAGTTCCCAAGATCAGCTTCTTCCAATGGCATCCATTCACTGTGTCTTTCTGTCGAGGCAACAAGATGATGCTGCACATCAAGACTGACGGC
AACTGGACTGCTAAGCTTCGTGAGCTTGGAGGTGATTCTGGAGAGTCTGAGATCGAAGTTGGCATCAACGGTCCCTTTGGTGCACCTGCTCAACGGTTCTACGACTTCAACCATTCCATC
ATCATCGGAGCTGGTATCGGCGTCACGCCATTTTCTGGTATCCTTGCCGATCTACAGTACAACGACGATCTCGACCACGGCGGCCCAAACCATGAAGTCGATCATCACCGTCACGACTCT
GAAGCAACTGCTATCCCACAAGCTGCTCGTCGATCGGACTCAAGTAGTAGCGATGAAGCGACCACCAGCGATAACGTACCCGAAACACCCACGCGACAAGGAAGTGTCGGCCCCGATCTC
ATCAACAAGGAGAAACAGCCCCAAGCCGATAAAGCAGGCAGCTTTGCAGAAGACTACCGAAGAGTGGATTTTCACTGGATGGTCCGTGAACGAAATTACCTCCTCTGGCTGTCCGACCTT
CTCAACGATGTATCCATGAGTCAAGACTGGCACCGCGAGCATGAAGACAAACCTCATCTCGACATCCGCATCAACACACACGTAACAGCCAAACAGAAGAAGATATCGACTCACGTGTAC
CGTTGGCTTTTGGAGATGCACCGCACAGATGAACATCCTGCATCGCCGCTTACTGGTCTTCTTAATCCCACGCACTTTGGCCGGCCCGACTTTGATCTTATCCTGGATGAGCATTATGAA
GAGATGCTCAAGTTTCGGGCGAGTAAGAGGACAAGTACAAGAAATAAAGAGGACGAGAATTATGAGGAAGATGAAGAGCTCAAGGTTGGCGTGTTTTACTGTGGTGCGCCTGTTGTGGGT
GAGATTCTGGCGGATAAGTGTCGTGAGCTCACGTTGCGGGGGTGGCAGGATGGAAGTAAGTTGGAGTATCACTTTATGATTGAGGTTTTTGGATGA

Retrieve as FASTA