Entry information : ZmPrx117 (GRMZM2G097934)
Entry ID 6677
Creation 2009-04-09 (Christophe Dunand)
Last sequence changes 2009-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-08-26 (Qiang Li)
Peroxidase information: ZmPrx117 (GRMZM2G097934)
Name (synonym) ZmPrx117 (GRMZM2G097934)
Class Class III peroxidase    [Orthogroup: Prx085]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx117
start..stop
S start..stop
SbPrx133 528 0 1..323 1..328
SiPrx40 475 2e-170 1..323 1..326
SiPrx28 468 1e-167 1..323 1..329
SiPrx41 465 2e-166 1..323 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 72701850..72702065 216 N° 2 72701009..72701767 759  
complement(join(72701009..72701767,72701850..72702065))


exon

Literature and cross-references ZmPrx117 (GRMZM2G097934)
Literature Brent,M.R., Langton,L., Comstock,C.L. and Zimmerman,R. Exhaustive RT-PCR and sequencing of all novel TWINSCAN predictions in Zea mays.
DNA ref. GenBank:   AC184133.3 (133905..132846)
EST ref. GenBank:   EY254575.1 [5' end]
Protein sequence: ZmPrx117 (GRMZM2G097934)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (300)
PWM (Da):   %s   35342.42 (32810.1)  
PI (pH):   %s   6.09 (5.86) Peptide Signal:   %s   cut: 25 range:25-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPSRTCSWLIVLSVLLVCTTANGDRLKVGYYDKTCPDVQQIVQSVMAFRVGRDQSVAPAVLRLFFHDCFVDGCDGSVLLDETPFFESEKDATPNANSLHGFDVIDEIKSYVEHACPATVSCADILALASRDAVALLGGPSWKVQLGRKDSRVANRTGAEYGLPAPNSTLAELINLFKQYDLDARDMAALSGAHTIGTARCHHYRDRVYGYNGEGGADIDPSFAELRRQTCQSAYDAPAPFDEQTPMRFDNAYYRDLVGRRGLLTSDQALYGYGGPLDHLVKMYSTNGEAFAKDFAKAIVKMGKIPPPHGMQGEIRLSCSKINR*

Retrieve as FASTA  
Remarks Complete sequence form genomic (Chromo 9, intron 1) and 1 EST. Cultivar="B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCCTTCCAGGACCTGTTCATGGCTGATCGTTCTCTCGGTTCTTCTGGTGTGCACTACTGCCAACGGGGACCGTCTAAAGGTTGGCTACTACGACAAGACGTGCCCCGATGTCCAG
CAGATCGTGCAGTCCGTGATGGCGTTCAGGGTCGGCCGCGACCAGTCGGTGGCACCCGCTGTGCTCCGCCTCTTCTTCCATGACTGCTTCGTCGAC
GTACGTCCCAATCTCATCGATCTT
TGTGCCTTGGGTCAAGTTTCTGCACTAACGATGACATCGATATTGACACGGCATGTAGGGATGCGACGGCTCCGTCCTCCTGGACGAGACGCCCTTTTTCGAGAGCGAGAAGGACGCCAC
GCCCAACGCCAACTCGCTCCACGGCTTCGACGTCATCGACGAGATCAAGTCTTACGTCGAGCATGCCTGCCCGGCCACGGTCTCCTGCGCCGACATCCTCGCGCTCGCCTCCCGCGACGC
TGTCGCCCTGCTCGGGGGCCCATCCTGGAAAGTGCAGCTCGGCCGCAAGGACTCGCGCGTCGCCAACAGGACCGGTGCCGAATACGGTCTCCCAGCTCCCAACTCCACGCTCGCCGAGCT
CATTAACCTGTTCAAGCAGTACGACCTCGATGCACGCGACATGGCGGCGCTCTCCGGCGCCCACACCATCGGCACGGCGCGGTGCCACCACTACAGGGACCGAGTCTACGGCTACAACGG
AGAGGGCGGCGCCGACATCGATCCCTCGTTTGCGGAGCTGCGCCGGCAGACATGCCAGTCCGCTTACGACGCGCCGGCTCCATTCGACGAGCAGACCCCAATGCGGTTTGACAACGCATA
CTACCGGGACCTGGTAGGGCGGCGCGGCCTCCTCACATCCGACCAGGCGCTCTACGGCTACGGTGGACCCCTGGACCATCTGGTGAAAATGTACAGCACGAACGGCGAGGCGTTCGCCAA
GGATTTCGCCAAGGCAATTGTGAAGATGGGTAAAATACCACCGCCACACGGGATGCAGGGGGAGATTAGACTCAGCTGCAGTAAGATCAACCGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCCTTCCAGGACCTGTTCATGGCTGATCGTTCTCTCGGTTCTTCTGGTGTGCACTACTGCCAACGGGGACCGTCTAAAGGTTGGCTACTACGACAAGACGTGCCCCGATGTCCAG
CAGATCGTGCAGTCCGTGATGGCGTTCAGGGTCGGCCGCGACCAGTCGGTGGCACCCGCTGTGCTCCGCCTCTTCTTCCATGACTGCTTCGTCGAC
GGATGCGACGGCTCCGTCCTCCTG
GACGAGACGCCCTTTTTCGAGAGCGAGAAGGACGCCACGCCCAACGCCAACTCGCTCCACGGCTTCGACGTCATCGACGAGATCAAGTCTTACGTCGAGCATGCCTGCCCGGCCACGGTC
TCCTGCGCCGACATCCTCGCGCTCGCCTCCCGCGACGCTGTCGCCCTGCTCGGGGGCCCATCCTGGAAAGTGCAGCTCGGCCGCAAGGACTCGCGCGTCGCCAACAGGACCGGTGCCGAA
TACGGTCTCCCAGCTCCCAACTCCACGCTCGCCGAGCTCATTAACCTGTTCAAGCAGTACGACCTCGATGCACGCGACATGGCGGCGCTCTCCGGCGCCCACACCATCGGCACGGCGCGG
TGCCACCACTACAGGGACCGAGTCTACGGCTACAACGGAGAGGGCGGCGCCGACATCGATCCCTCGTTTGCGGAGCTGCGCCGGCAGACATGCCAGTCCGCTTACGACGCGCCGGCTCCA
TTCGACGAGCAGACCCCAATGCGGTTTGACAACGCATACTACCGGGACCTGGTAGGGCGGCGCGGCCTCCTCACATCCGACCAGGCGCTCTACGGCTACGGTGGACCCCTGGACCATCTG
GTGAAAATGTACAGCACGAACGGCGAGGCGTTCGCCAAGGATTTCGCCAAGGCAATTGTGAAGATGGGTAAAATACCACCGCCACACGGGATGCAGGGGGAGATTAGACTCAGCTGCAGT
AAGATCAACCGGTGA

Retrieve as FASTA