Entry information : ZmPrx119 (GRMZM2G382379)
Entry ID 6679
Creation 2009-04-09 (Christophe Dunand)
Last sequence changes 2011-01-25 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx119 (GRMZM2G382379)
Name (synonym) ZmPrx119 (GRMZM2G382379)
Class Class III peroxidase    [Orthogroup: Prx175]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Endosperm
Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx119
start..stop
S start..stop
SbPrx50 482 9e-173 1..342 1..337
SiPrx20 463 2e-165 41..342 27..321
OsPrx02 439 5e-156 30..342 14..317
OsPrx86 398 1e-139 40..342 32..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23636624..23636878 255 N° 2 23637006..23637200 195 N° 3 23637305..23637883 579  
join(23636624..23636878,23637006..23637200,23637305..23637883)


exon

Literature and cross-references ZmPrx119 (GRMZM2G382379)
Protein ref. UniProtKB:   B6U2M7
mRNA ref. GenBank:   EU971492
Cluster/Prediction ref. UniGene:   Zm.30385
Protein sequence: ZmPrx119 (GRMZM2G382379)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (308)
PWM (Da):   %s   34904.65 (31609.9) Transmb domain:   %s   i12-34o
PI (pH):   %s   7.92 (7.68) Peptide Signal:   %s   cut: 35 range:35-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGARATMGCSPLLPFQALWLTAAVVAALALAAGAQPSPSLSPGFYDATCPGLQPIVRRGVARAVRAEPRMGASLLRLFFHDCFVNGCDASVLLDDVPGNFTGEKNAGPNANSLRGYEVIDAIKAQVEASCKATVSCADILALAARDAVNLLGGPRWAVPLGRRDARDASAGAANANLPPPDASLPALLSAFGAKGLDARDLTALSGAHTVGRARCAVFRAHIYNDTATTDASFAAGLRGAVCPYTGGDANLAPLEPQAPDAFDNGYFRDLVARRVLLRSDQALYGSGGDGGNTTDALVRAYAANGTAFAADFAAAMVRMGNLGPPAASAAAAEVRLNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, introns 1 and 2) and 42 ESTs. Incorrect prediction from Phytozome (last exon is missing due to a sequence shift GTGGGG(g)CGCGCCCGCT => extra g confirmed with ESTs). Also found in AC197153.3.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCGCGGGCGACGATGGGATGTTCGCCCTTGCTGCCCTTCCAAGCGCTCTGGCTCACAGCGGCCGTTGTCGCGGCGCTCGCGCTCGCGGCCGGCGCGCAGCCGTCGCCGTCGCTG
TCGCCGGGGTTCTACGACGCGACGTGCCCGGGGCTGCAGCCCATCGTGCGCCGCGGCGTGGCGCGCGCCGTCCGGGCGGAGCCGCGCATGGGGGCGTCCCTCCTCCGCCTCTTCTTCCAC
GACTGCTTCGTCAAT
GTAAGACGACGGGCGCGAGGGAGTGGAGCGGTCACTCACTTCGCTTCACGCCTGTCGGTCGGTCGGTCGGTTTGTGCTGGTCCTCTCCTGACGTGTGTCCGTGCG
TGTGGATGGATATGGATCGCAGGGCTGCGACGCCTCCGTCTTGCTGGACGACGTGCCCGGTAACTTCACCGGGGAGAAGAACGCGGGGCCCAACGCCAACTCGCTGCGCGGGTACGAGGT
CATCGACGCCATCAAGGCCCAGGTGGAGGCGTCCTGCAAGGCCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCAGCGCGCGACGCCGTCAACCTG
GTCAGCGTTCCTGCTCGTCCTCT
CTCCGGCTCCGTTTCCAAACAAACAAACAAACAAACAAACAGCTGCATGCGCCGCCTGACCGACCGTGTGCCGAGGTGCAGCTGGGCGGGCCGCGGTGGGCGGTGCCGCTGGGGCGGCGG
GACGCGCGGGACGCGAGCGCGGGCGCGGCGAACGCCAACCTGCCGCCTCCGGACGCGTCGCTGCCGGCGCTGCTGTCCGCGTTCGGCGCCAAGGGCCTGGACGCGCGGGACCTGACGGCG
CTGTCGGGCGCGCACACGGTGGGGCGCGCCCGCTGCGCGGTGTTCCGCGCCCACATCTACAACGACACCGCCACCACCGACGCCAGCTTCGCGGCGGGCCTCCGGGGCGCCGTCTGCCCC
TACACGGGCGGCGACGCCAACCTGGCGCCGCTGGAGCCGCAGGCGCCCGACGCCTTCGACAACGGCTACTTCCGGGACCTGGTCGCGCGCCGCGTGCTGCTTCGCTCGGACCAGGCGCTG
TACGGCAGCGGCGGAGACGGGGGCAACACCACGGACGCGCTCGTGCGCGCGTACGCCGCCAACGGGACGGCCTTCGCGGCCGACTTCGCCGCCGCCATGGTGAGGATGGGGAACCTGGGC
CCGCCCGCGGCGAGCGCGGCCGCCGCCGAGGTCCGGCTCAACTGCCGCCGAGTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCGCGGGCGACGATGGGATGTTCGCCCTTGCTGCCCTTCCAAGCGCTCTGGCTCACAGCGGCCGTTGTCGCGGCGCTCGCGCTCGCGGCCGGCGCGCAGCCGTCGCCGTCGCTG
TCGCCGGGGTTCTACGACGCGACGTGCCCGGGGCTGCAGCCCATCGTGCGCCGCGGCGTGGCGCGCGCCGTCCGGGCGGAGCCGCGCATGGGGGCGTCCCTCCTCCGCCTCTTCTTCCAC
GACTGCTTCGTCAAT
GGCTGCGACGCCTCCGTCTTGCTGGACGACGTGCCCGGTAACTTCACCGGGGAGAAGAACGCGGGGCCCAACGCCAACTCGCTGCGCGGGTACGAGGTCATCGAC
GCCATCAAGGCCCAGGTGGAGGCGTCCTGCAAGGCCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCAGCGCGCGACGCCGTCAACCTG
CTGGGCGGGCCGCGGTGGGCGGTGCCGCTG
GGGCGGCGGGACGCGCGGGACGCGAGCGCGGGCGCGGCGAACGCCAACCTGCCGCCTCCGGACGCGTCGCTGCCGGCGCTGCTGTCCGCGTTCGGCGCCAAGGGCCTGGACGCGCGGGAC
CTGACGGCGCTGTCGGGCGCGCACACGGTGGGGCGCGCCCGCTGCGCGGTGTTCCGCGCCCACATCTACAACGACACCGCCACCACCGACGCCAGCTTCGCGGCGGGCCTCCGGGGCGCC
GTCTGCCCCTACACGGGCGGCGACGCCAACCTGGCGCCGCTGGAGCCGCAGGCGCCCGACGCCTTCGACAACGGCTACTTCCGGGACCTGGTCGCGCGCCGCGTGCTGCTTCGCTCGGAC
CAGGCGCTGTACGGCAGCGGCGGAGACGGGGGCAACACCACGGACGCGCTCGTGCGCGCGTACGCCGCCAACGGGACGGCCTTCGCGGCCGACTTCGCCGCCGCCATGGTGAGGATGGGG
AACCTGGGCCCGCCCGCGGCGAGCGCGGCCGCCGCCGAGGTCCGGCTCAACTGCCGCCGAGTGAACTGA

Retrieve as FASTA