Entry information : ZmPrx124
Entry ID 6685
Creation 2009-04-09 (Christophe Dunand)
Last sequence changes 2009-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx124
Name ZmPrx124
Class Class III peroxidase    [Orthogroup: Prx175]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx124
start..stop
S start..stop
SbPrx67 569 0 25..342 30..348
SiPrx13 505 0 26..342 27..343
OsPrx19 479 9e-172 1..342 1..336
BdiPrx94 461 2e-164 6..342 9..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 189851386..189851640 255 N° 2 189851751..189851936 186 N° 3 189852053..189852218 166 N° 4 189852345..189852766 422
join(189851386..189851640,189851751..189851936,189852053..189852218,189852345..1 89852766)


exon

Literature and cross-references ZmPrx124
Literature Alexandrov,N.N., Brover,V.V., Freidin,S., Troukhan,M.E., Tatarinova,T.V., Zhang,H., Swaller,T.J., Lu,Y.P., Bouck,J., Flavell,R.B. and Feldmann,K.A. Insights into corn genes derived from large-scale cDNA sequencing. Plant Mol. Biol. 69 (1-2), 179-194 (2009).
DNA ref. GenBank:   AC195142.3 (82069..83449)
mRNA ref. GenBank:   EU974442
Cluster/Prediction ref. UniGene:   Zm.41466
Protein sequence: ZmPrx124
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (319)
PWM (Da):   %s   37281.43 (34779.9)  
PI (pH):   %s   4.67 (4.40) Peptide Signal:   %s   cut: 24 range:24-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALRRRLLLLVVVVAAAVARCRADDPAVSMLLPGLPVAGLAVGFYNEKCPQAEDLVLAEMRTLVDKDETIGPALLRFMFHDCLVRGCDASIMLVSRNGTAERDAFPSYGLRGYAEIEHIKAKLEDACPLTVSCADIIVMAARDAVYLSNGPRYAVETGRRDGKVSAEYDADNDLPPPSSKIVDLKTYFSFKGLGWKDLVVLSGSHTIGRAQCTTFASDRLYNYSGHVGQDPSLNKAYAAQLREMCEPGLADDTTMVEMDPRSPYTFDLSYYRNVRANRGLFTSDQALLDDPWTSAYVERMADAASPDEFFADYAAAITNMGRIEVLTGDNGEIRSACAAYVD

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns) and 11 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGAGGCGGCGGCTGTTGCTGCTGGTGGTGGTCGTGGCGGCCGCCGTCGCTCGCTGCCGGGCGGACGACCCCGCGGTGAGCATGCTGCTGCCGGGACTCCCGGTCGCCGGCCTC
GCCGTGGGGTTCTACAACGAGAAGTGCCCGCAGGCGGAGGACCTGGTGCTCGCCGAGATGCGGACCCTCGTCGACAAAGACGAGACCATCGGCCCGGCGCTGCTGCGCTTCATGTTCCAC
GACTGCCTCGTCCGG
GTGCGTACGTTGCCGCAGCCGGCCTTCTCATCGTCTGCCTACTGCTTGATACGAGCTTCCTGGATGTCTTTTTTTTTTTGTTGTTGTTGTTGCCTCGCGCGCGTG
CGCAGGGCTGCGACGCGTCGATCATGCTCGTCTCGCGGAACGGGACTGCGGAGAGGGACGCCTTCCCGAGCTACGGCCTCCGGGGCTACGCCGAGATCGAGCACATCAAGGCCAAGCTGG
AGGACGCGTGCCCGCTGACCGTGTCGTGCGCGGACATCATCGTCATGGCGGCCCGGGACGCCGTGTACCTG
GTAAATAAAATAATTATAAGCAGCCTCCGACATAATTTGTTGCTCTCCT
CGATCGGACCATATCAACCTAGCTACACATTAATTGAATTGAAGAAGCGGCTTCTCCTTGTTCCCAGAGCAACGGGCCGCGGTACGCCGTGGAGACCGGCCGCCGCGACGGCAAGGTGTC
GGCGGAGTACGACGCCGACAACGACCTCCCGCCGCCCTCCTCCAAAATCGTCGACCTCAAGACCTACTTCAGCTTCAAGGGGTTGGGCTGGAAGGACCTCGTCGTGCTGTCAG
GTACAAT
ACAACCAATGAGCTGTCCAACTACGTACGTACGTACGTCCTGCAAGCAAAGTAGCTAGACGACTGATCGATCGACGACGGTGGTACACACGGAACAATCCCTGACTGCATGCAGTGCAGG
AAGCCACACGATCGGGAGGGCGCAGTGCACCACGTTCGCGTCGGACCGGCTGTACAACTACAGCGGCCACGTGGGGCAGGACCCGTCGCTGAACAAGGCGTACGCGGCGCAGCTGCGGGA
GATGTGCGAGCCGGGGCTCGCCGACGACACCACCATGGTGGAGATGGACCCGCGCAGCCCCTACACCTTCGACCTCAGCTACTACCGCAACGTGCGCGCCAACCGGGGCCTCTTCACCTC
GGACCAGGCCCTCCTCGACGACCCGTGGACCAGCGCGTACGTCGAGCGCATGGCCGACGCGGCGTCGCCCGACGAATTCTTCGCCGACTACGCGGCCGCCATCACCAACATGGGCCGCAT
CGAGGTGCTCACGGGTGACAACGGCGAGATCAGGAGCGCCTGCGCCGCGTACGTTGACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGAGGCGGCGGCTGTTGCTGCTGGTGGTGGTCGTGGCGGCCGCCGTCGCTCGCTGCCGGGCGGACGACCCCGCGGTGAGCATGCTGCTGCCGGGACTCCCGGTCGCCGGCCTC
GCCGTGGGGTTCTACAACGAGAAGTGCCCGCAGGCGGAGGACCTGGTGCTCGCCGAGATGCGGACCCTCGTCGACAAAGACGAGACCATCGGCCCGGCGCTGCTGCGCTTCATGTTCCAC
GACTGCCTCGTCCGG
GGCTGCGACGCGTCGATCATGCTCGTCTCGCGGAACGGGACTGCGGAGAGGGACGCCTTCCCGAGCTACGGCCTCCGGGGCTACGCCGAGATCGAGCACATCAAG
GCCAAGCTGGAGGACGCGTGCCCGCTGACCGTGTCGTGCGCGGACATCATCGTCATGGCGGCCCGGGACGCCGTGTACCTG
AGCAACGGGCCGCGGTACGCCGTGGAGACCGGCCGCCGC
GACGGCAAGGTGTCGGCGGAGTACGACGCCGACAACGACCTCCCGCCGCCCTCCTCCAAAATCGTCGACCTCAAGACCTACTTCAGCTTCAAGGGGTTGGGCTGGAAGGACCTCGTCGTG
CTGTCAG
GAAGCCACACGATCGGGAGGGCGCAGTGCACCACGTTCGCGTCGGACCGGCTGTACAACTACAGCGGCCACGTGGGGCAGGACCCGTCGCTGAACAAGGCGTACGCGGCGCAG
CTGCGGGAGATGTGCGAGCCGGGGCTCGCCGACGACACCACCATGGTGGAGATGGACCCGCGCAGCCCCTACACCTTCGACCTCAGCTACTACCGCAACGTGCGCGCCAACCGGGGCCTC
TTCACCTCGGACCAGGCCCTCCTCGACGACCCGTGGACCAGCGCGTACGTCGAGCGCATGGCCGACGCGGCGTCGCCCGACGAATTCTTCGCCGACTACGCGGCCGCCATCACCAACATG
GGCCGCATCGAGGTGCTCACGGGTGACAACGGCGAGATCAGGAGCGCCTGCGCCGCGTACGTTGACTAG

Retrieve as FASTA