Entry information : ZmPrx125(Zm00001d005279 / GRMZM2G136042)
Entry ID 6687
Creation 2009-04-10 (Christophe Dunand)
Last sequence changes 2009-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-04 (Christophe Dunand)
Peroxidase information: ZmPrx125(Zm00001d005279 / GRMZM2G136042)
Name ZmPrx125(Zm00001d005279 / GRMZM2G136042)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx125
start..stop
S start..stop
SiPrx125 534 0 17..320 23..328
HvPrx35 488 1.32e-175 6..320 9..326
OsPrx98 487 3.96e-175 17..320 26..330
TaPrx188-1B 483 8.5e-174 15..320 17..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6687' 'complement(join(162582029..162582193,162582360..162583157))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 162582360..162583157 796 N° 2 162582029..162582193 163  
complement(join(162582029..162582193,162582360..162583157))


exon

Literature and cross-references ZmPrx125(Zm00001d005279 / GRMZM2G136042)
DNA ref. GenBank:   AC207350.4 (176726..175599)
mRNA ref. GenBank:   EU972037.1
Cluster/Prediction ref. UniGene:   Zm.134413
Protein sequence: ZmPrx125(Zm00001d005279 / GRMZM2G136042)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (299)
PWM (Da):   %s   33671.25 (31730.2)  
PI (pH):   %s   8.64 (8.57) Peptide Signal:   %s   cut: 22 range:22-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSAAALLLALAAAGSVCSAQQLRRNYYASVCPNVESIVRDAVA
KKYRETFITVGATVHLFFHDCFVEGCDASVVVASTPNATAEKDHPINLSLAGDGFDTVIRAKAAVDAVPRCRNRV
SCADILAMATRDAIALAGGPAYAVELGRLDGLSSTATSVNG
KLAPPSFGLDQLTALFARNGLSQADMVALSAGHTVGFAHCGTFSGRVRAADPTLNRSLAEKLAAWCPDGVDPRVAVTMDVVTPRVFDNQYFRNLQSGMGLLASDQ
VLYTDPRSRPTVDALARSKVAFERAFVEGITKMGRIGVKTGAQGNIRRNCAVLN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 3') and 2 ESTs. Also found in AC217658.3 (5'end). Containing IntR (3'). Incorrect prediction from Phytozome (splicing error)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTTTCAGCGGCGGCGCTCCTGCTGGCGCTGGCCGCGGCTGGCAGCGTCTGCTCGGCGCAGCAGCTCCGTCGCAACTACTACGCGAGCGTGTGCCCGAACGTGGAGTCCATCGTG
CGCGACGCGGTGGCGAAGAAGTACCGGGAGACGTTCATCACGGTGGGCGCGACGGTGCACCTCTTCTTCCACGACTGCTTCGTGGAGGGCTGCGACGCCTCCGTGGTGGTGGCGTCCACG
CCAAACGCCACCGCGGAGAAGGACCACCCCATCAACCTGTCCCTGGCGGGCGATGGCTTCGACACCGTGATCCGGGCCAAGGCCGCCGTGGACGCCGTGCCGCGGTGCCGGAACAGGGTG
TCCTGCGCCGACATCCTGGCCATGGCCACCCGGGACGCCATCGCGCTGGCCGGCGGGCCCGCGTACGCGGTGGAGCTGGGCCGCCTGGACGGGCTGTCCTCCACGGCGACCAGCGTGAAC
GGGAAGCTGGCGCCGCCGTCGTTTGGCCTGGACCAGCTCACCGCGCTGTTCGCGCGCAACGGGCTCTCGCAGGCCGACATGGTGGCGCTATCGGCGGGGCACACGGTGGGGTTCGCGCAC
TGCGGAACCTTCTCCGGGCGGGTCCGCGCGGCGGACCCGACGCTGAACCGGAGCCTGGCGGAGAAGCTGGCGGCGTGGTGCCCCGACGGCGTGGACCCGCGGGTGGCGGTGACCATGGAC
GTGGTCACGCCCAGGGTGTTCGACAACCAGTACTTCCGGAACCTGCAGAGCGGGATGGGCCTCCTGGCGTCGGACCAG
GTGCTGTTAGGGGTGGTAATGGATCGTGATCCAAATAGTTCT
TCACAAAATGTCAAAGCCCTAAATAAATTATAGTTCAAAAATGACTATAAATAGAGCCCGATCCTAACCCGCTTCGATCCTTAAATCTTATAGTGCAAAATTTATAGCCCATTGTCAGCC
CTAGGTGTGCTGTACACGGACCCCAGGTCTAGGCCCACCGTCGACGCGTTGGCCCGGAGTAAAGTGGCCTTTGAACGGGCCTTTGTGGAGGGGATCACGAAGATGGGCCGGATCGGGGTC
AAGACGGGTGCCCAAGGGAACATCCGACGTAACTGCGCAGTGCTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTTTCAGCGGCGGCGCTCCTGCTGGCGCTGGCCGCGGCTGGCAGCGTCTGCTCGGCGCAGCAGCTCCGTCGCAACTACTACGCGAGCGTGTGCCCGAACGTGGAGTCCATCGTG
CGCGACGCGGTGGCGAAGAAGTACCGGGAGACGTTCATCACGGTGGGCGCGACGGTGCACCTCTTCTTCCACGACTGCTTCGTGGAGGGCTGCGACGCCTCCGTGGTGGTGGCGTCCACG
CCAAACGCCACCGCGGAGAAGGACCACCCCATCAACCTGTCCCTGGCGGGCGATGGCTTCGACACCGTGATCCGGGCCAAGGCCGCCGTGGACGCCGTGCCGCGGTGCCGGAACAGGGTG
TCCTGCGCCGACATCCTGGCCATGGCCACCCGGGACGCCATCGCGCTGGCCGGCGGGCCCGCGTACGCGGTGGAGCTGGGCCGCCTGGACGGGCTGTCCTCCACGGCGACCAGCGTGAAC
GGGAAGCTGGCGCCGCCGTCGTTTGGCCTGGACCAGCTCACCGCGCTGTTCGCGCGCAACGGGCTCTCGCAGGCCGACATGGTGGCGCTATCGGCGGGGCACACGGTGGGGTTCGCGCAC
TGCGGAACCTTCTCCGGGCGGGTCCGCGCGGCGGACCCGACGCTGAACCGGAGCCTGGCGGAGAAGCTGGCGGCGTGGTGCCCCGACGGCGTGGACCCGCGGGTGGCGGTGACCATGGAC
GTGGTCACGCCCAGGGTGTTCGACAACCAGTACTTCCGGAACCTGCAGAGCGGGATGGGCCTCCTGGCGTCGGACCAG
GTGCTGTACACGGACCCCAGGTCTAGGCCCACCGTCGACGCG
TTGGCCCGGAGTAAAGTGGCCTTTGAACGGGCCTTTGTGGAGGGGATCACGAAGATGGGCCGGATCGGGGTCAAGACGGGTGCCCAAGGGAACATCCGACGTAACTGCGCAGTGCTCAAT
TGA

Retrieve as FASTA