Entry information : ZmPrx126
Entry ID 6688
Creation 2009-04-10 (Christophe Dunand)
Last sequence changes 2009-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx126
Name ZmPrx126
Class Class III peroxidase    [Orthogroup: Prx138]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx126
start..stop
S start..stop
SbPrx09 571 0 1..317 15..331
SiPrx156 521 0 14..317 28..330
SiPrx158 520 0 1..317 13..329
SbPrx11 520 0 13..317 26..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 113712869..113713060 192 N° 2 113711974..113712735 762  
complement(join(113711974..113712735,113712869..113713060))


exon

Literature and cross-references ZmPrx126
DNA ref. GenBank:   AC203571.3 (41209..40123)
Protein sequence: ZmPrx126
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (302)
PWM (Da):   %s   33949.4 (32637.7)  
PI (pH):   %s   8.89 (8.89) Peptide Signal:   %s   cut: 16 range:16-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAVSVLALAAAGSAQLQYGFYKGKCNGTDVEALVQSIVRARFARENPIVAYLLRMQFHECAVNGCDGGLLIDGPGTEKTAPPNLSVKGYDVIAAVKAELERKCPGVVSCSDIQILATRDAVALAGGAAYAVRTGRRDRRRSLAPDVRLPAPEFTAAQMVAYFGGLGLSAFDAVLLLGAHTVGATRCSAIKGSRLYRYGGRAGATDPGMDPGYAFVYKNYVCPNVPSSDNNAVFLDDQWSALKLDNHYYRNLQQRRGVLACDQNLYSDGSTRWIVDLLAKDSGLFTSLFPKALVKLSEVNVVTGTQGEIRKVCNRFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, intron 1). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCCGTCTCCGTCCTGGCACTGGCCGCCGCCGGCAGCGCGCAGCTGCAGTACGGGTTCTACAAGGGCAAGTGCAACGGCACCGACGTGGAGGCGCTGGTGCAGAGTATCGTCAGG
GCCCGCTTTGCGCGCGAGAACCCCATCGTCGCCTACCTCCTCCGCATGCAGTTCCACGAGTGCGCCGTCAAT
GTACGTGTACAACGTGTCTAGCTAGGCAGCTAGCTAGCCCACGCGCCG
ACGCGCGCGCGCGTGTGTTCCGCTGGTTCGTTAACGAGATGACACACGACACTACGGTATATGTATAATAGCAATATAATTGCAGGGCTGTGACGGTGGTTTGCTGATCGACGGCCCCGG
CACCGAGAAGACGGCGCCGCCGAACCTCAGCGTCAAGGGCTACGACGTCATCGCGGCCGTCAAGGCGGAGCTGGAGCGGAAGTGTCCCGGCGTCGTGTCCTGCTCCGACATCCAGATCCT
CGCCACCCGGGACGCCGTGGCGCTGGCCGGCGGGGCCGCGTACGCGGTGCGCACGGGGCGGAGGGACCGCCGCCGGTCGCTGGCCCCCGACGTCAGGCTCCCGGCGCCCGAGTTCACCGC
GGCGCAGATGGTGGCGTACTTCGGCGGGCTGGGCCTGAGCGCGTTCGACGCGGTGCTGCTGCTGGGCGCGCACACCGTGGGCGCCACGCGCTGCAGCGCGATCAAGGGCAGCCGGCTGTA
CCGGTACGGCGGCAGGGCCGGCGCCACGGACCCCGGCATGGACCCGGGCTACGCGTTCGTGTACAAGAACTACGTGTGCCCCAACGTGCCCTCGTCGGACAACAACGCCGTGTTCCTGGA
CGACCAGTGGAGCGCGCTCAAGCTGGACAACCACTACTACAGGAACCTGCAGCAGCGCCGCGGCGTGCTCGCCTGCGACCAGAACCTGTACAGCGACGGGTCCACGCGCTGGATCGTGGA
CCTGCTCGCCAAAGACAGCGGCCTCTTCACCTCGCTCTTCCCCAAGGCGCTCGTCAAGCTCAGCGAGGTCAACGTGGTCACCGGCACGCAGGGGGAGATCCGAAAGGTCTGCAACAGATT
CAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCCGTCTCCGTCCTGGCACTGGCCGCCGCCGGCAGCGCGCAGCTGCAGTACGGGTTCTACAAGGGCAAGTGCAACGGCACCGACGTGGAGGCGCTGGTGCAGAGTATCGTCAGG
GCCCGCTTTGCGCGCGAGAACCCCATCGTCGCCTACCTCCTCCGCATGCAGTTCCACGAGTGCGCCGTCAAT
GGCTGTGACGGTGGTTTGCTGATCGACGGCCCCGGCACCGAGAAGACG
GCGCCGCCGAACCTCAGCGTCAAGGGCTACGACGTCATCGCGGCCGTCAAGGCGGAGCTGGAGCGGAAGTGTCCCGGCGTCGTGTCCTGCTCCGACATCCAGATCCTCGCCACCCGGGAC
GCCGTGGCGCTGGCCGGCGGGGCCGCGTACGCGGTGCGCACGGGGCGGAGGGACCGCCGCCGGTCGCTGGCCCCCGACGTCAGGCTCCCGGCGCCCGAGTTCACCGCGGCGCAGATGGTG
GCGTACTTCGGCGGGCTGGGCCTGAGCGCGTTCGACGCGGTGCTGCTGCTGGGCGCGCACACCGTGGGCGCCACGCGCTGCAGCGCGATCAAGGGCAGCCGGCTGTACCGGTACGGCGGC
AGGGCCGGCGCCACGGACCCCGGCATGGACCCGGGCTACGCGTTCGTGTACAAGAACTACGTGTGCCCCAACGTGCCCTCGTCGGACAACAACGCCGTGTTCCTGGACGACCAGTGGAGC
GCGCTCAAGCTGGACAACCACTACTACAGGAACCTGCAGCAGCGCCGCGGCGTGCTCGCCTGCGACCAGAACCTGTACAGCGACGGGTCCACGCGCTGGATCGTGGACCTGCTCGCCAAA
GACAGCGGCCTCTTCACCTCGCTCTTCCCCAAGGCGCTCGTCAAGCTCAGCGAGGTCAACGTGGTCACCGGCACGCAGGGGGAGATCCGAAAGGTCTGCAACAGATTCAACTGA

Retrieve as FASTA