Entry information : ZmPrx132
Entry ID 6694
Creation 2009-04-10 (Christophe Dunand)
Last sequence changes 2009-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx132
Name ZmPrx132
Class Class III peroxidase    [Orthogroup: Prx126]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx132
start..stop
S start..stop
ZmPrx53 697 0 1..441 1..436
SbPrx22 647 0 25..440 28..436
SiPrx169 561 0 1..354 1..358
OsPrx36 457 5e-159 25..371 28..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11524931..11525137 207 N° 2 11525214..11526338 1125  
join(11524931..11525137,11525214..11526338)


exon

Literature and cross-references ZmPrx132
DNA ref. GenBank:   AC190650.3 (90768..89361)
Protein sequence: ZmPrx132
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   443 (421)
PWM (Da):   %s   46538.46 (44372.2)  
PI (pH):   %s   4.73 (4.72) Peptide Signal:   %s   cut: 23 range:23-443
Sequence 484
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDARLVFLLLLAAAASAPLASAQLSADFYKTSCPDAEKIIFDVVQKRFKADPGTAAGLLRLVFHDCFANGCDASILIDPMSNQASEKEAGPNVSVKGYDVIEEIKTELEKKCPNVVSCADIISVSARDSVKLTGGPEYAVPLGRRDSLVSNREDADNLPGPDIAVPKLIDEFDKQGFNVEEMVAMLGGGHSIGVCRCFFIETDAAPIDPKYKKTISDACDGKDSGSVPMDSTSPNDLDGSYFGLVLEKKMPLTIDRLMGMDKKTEPIVKAMSDKTTDFVPIFAKAMEKLSVLKVLTGKEGEIRKTCSEFNNPQNSSGSTSVIRISSIDPDQMAGLSQPGSSSRKVGPPPVEEETPAMVATEAAAKVPGGVVVSVGGGQQPAAQASGQEKVADTPGPKLRGSQETVNPAPVVSGAGAEEADKQEGAAALEEKKKRNMAKLRGGA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1) and 10 ESTs. Also found in AC232222.3
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGACGCCCGCCTCGTCTTCCTCCTCCTCCTCGCGGCCGCGGCGTCCGCGCCGCTGGCCTCCGCGCAGCTCTCGGCGGATTTCTACAAGACGTCGTGCCCCGACGCCGAGAAGATCATCT
TCGACGTCGTCCAGAAGCGGTTCAAAGCTGACCCCGGCACCGCCGCCGGCCTCCTCCGCCTCGTCTTCCACGACTGCTTCGCAAAC
GTACGTAACGTAATTAAGCTGCTTCGTCGTCGTC
AGACTCAGACATATGAACGTGTTTAATTTGTCTCGTCTCCAGGGCTGCGACGCGTCCATCCTGATCGACCCGATGTCGAACCAGGCCTCCGAGAAGGAGGCCGGCCCCAACGTCTCCGTG
AAGGGCTACGACGTGATCGAGGAGATCAAGACGGAGCTGGAGAAGAAGTGCCCGAACGTGGTGTCGTGCGCGGACATCATCTCGGTGAGCGCCCGCGACTCGGTGAAGCTGACGGGCGGG
CCCGAGTACGCGGTGCCCCTGGGACGGCGCGACTCGCTCGTGTCCAACCGCGAGGACGCCGACAACCTGCCGGGCCCGGACATCGCGGTGCCCAAGCTCATCGACGAGTTCGACAAGCAG
GGCTTCAACGTCGAGGAGATGGTCGCGATGCTGGGCGGCGGCCACAGCATCGGCGTCTGCAGGTGCTTCTTCATCGAGACCGACGCGGCGCCCATCGACCCCAAGTACAAGAAGACGATC
AGCGACGCGTGCGACGGCAAGGACTCGGGCTCCGTCCCCATGGACTCCACCTCGCCCAACGACCTGGACGGGAGCTACTTCGGCCTGGTGCTGGAGAAGAAGATGCCGCTCACCATCGAC
CGCCTGATGGGGATGGACAAGAAGACGGAGCCCATAGTGAAGGCCATGTCGGACAAGACCACCGACTTCGTCCCGATCTTCGCCAAGGCCATGGAGAAGCTCAGCGTGCTCAAGGTGCTC
ACGGGGAAGGAAGGCGAGATCAGGAAGACGTGCTCCGAGTTCAACAACCCGCAGAACAGCAGCGGCAGCACGTCGGTGATACGGATCAGCTCCATCGACCCCGACCAGATGGCCGGGCTG
TCGCAGCCAGGGTCGTCGTCCAGGAAGGTGGGCCCTCCTCCCGTCGAGGAGGAAACACCCGCCATGGTGGCGACCGAGGCGGCCGCCAAGGTTCCGGGTGGTGTGGTCGTCAGCGTCGGA
GGAGGACAGCAGCCGGCCGCCCAAGCGTCAGGCCAGGAGAAGGTGGCGGATACGCCCGGCCCCAAGCTCCGCGGAAGCCAGGAGACTGTGAACCCGGCCCCGGTGGTGTCCGGCGCCGGC
GCCGAGGAGGCCGACAAGCAGGAGGGGGCGGCGGCCCTGGAGGAGAAGAAGAAGAGGAACATGGCCAAACTCCGCGGCGGTGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGACGCCCGCCTCGTCTTCCTCCTCCTCCTCGCGGCCGCGGCGTCCGCGCCGCTGGCCTCCGCGCAGCTCTCGGCGGATTTCTACAAGACGTCGTGCCCCGACGCCGAGAAGATCATCT
TCGACGTCGTCCAGAAGCGGTTCAAAGCTGACCCCGGCACCGCCGCCGGCCTCCTCCGCCTCGTCTTCCACGACTGCTTCGCAAAC
GGCTGCGACGCGTCCATCCTGATCGACCCGATGT
CGAACCAGGCCTCCGAGAAGGAGGCCGGCCCCAACGTCTCCGTGAAGGGCTACGACGTGATCGAGGAGATCAAGACGGAGCTGGAGAAGAAGTGCCCGAACGTGGTGTCGTGCGCGGACA
TCATCTCGGTGAGCGCCCGCGACTCGGTGAAGCTGACGGGCGGGCCCGAGTACGCGGTGCCCCTGGGACGGCGCGACTCGCTCGTGTCCAACCGCGAGGACGCCGACAACCTGCCGGGCC
CGGACATCGCGGTGCCCAAGCTCATCGACGAGTTCGACAAGCAGGGCTTCAACGTCGAGGAGATGGTCGCGATGCTGGGCGGCGGCCACAGCATCGGCGTCTGCAGGTGCTTCTTCATCG
AGACCGACGCGGCGCCCATCGACCCCAAGTACAAGAAGACGATCAGCGACGCGTGCGACGGCAAGGACTCGGGCTCCGTCCCCATGGACTCCACCTCGCCCAACGACCTGGACGGGAGCT
ACTTCGGCCTGGTGCTGGAGAAGAAGATGCCGCTCACCATCGACCGCCTGATGGGGATGGACAAGAAGACGGAGCCCATAGTGAAGGCCATGTCGGACAAGACCACCGACTTCGTCCCGA
TCTTCGCCAAGGCCATGGAGAAGCTCAGCGTGCTCAAGGTGCTCACGGGGAAGGAAGGCGAGATCAGGAAGACGTGCTCCGAGTTCAACAACCCGCAGAACAGCAGCGGCAGCACGTCGG
TGATACGGATCAGCTCCATCGACCCCGACCAGATGGCCGGGCTGTCGCAGCCAGGGTCGTCGTCCAGGAAGGTGGGCCCTCCTCCCGTCGAGGAGGAAACACCCGCCATGGTGGCGACCG
AGGCGGCCGCCAAGGTTCCGGGTGGTGTGGTCGTCAGCGTCGGAGGAGGACAGCAGCCGGCCGCCCAAGCGTCAGGCCAGGAGAAGGTGGCGGATACGCCCGGCCCCAAGCTCCGCGGAA
GCCAGGAGACTGTGAACCCGGCCCCGGTGGTGTCCGGCGCCGGCGCCGAGGAGGCCGACAAGCAGGAGGGGGCGGCGGCCCTGGAGGAGAAGAAGAAGAGGAACATGGCCAAACTCCGCG
GCGGTGCCTAG

Retrieve as FASTA