Entry information : ZmPrx132(Zm00001d027710 / GRMZM2G122816)
Entry ID 6694
Creation 2009-04-10 (Christophe Dunand)
Last sequence changes 2009-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-12-30 (Christophe Dunand)
Peroxidase information: ZmPrx132(Zm00001d027710 / GRMZM2G122816)
Name ZmPrx132(Zm00001d027710 / GRMZM2G122816)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx132
start..stop
S start..stop
ZmPrx53 697 0 1..441 1..436
SbPrx22 647 0 25..440 28..436
SiPrx169 561 0 1..354 1..358
BdiPrx43 456 3.6e-159 1..340 55..399
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6694' 'join(11524931..11525137,11525214..11526338)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11524931..11525137 205 N° 2 11525214..11526338 1123  
join(11524931..11525137,11525214..11526338)


exon

Literature and cross-references ZmPrx132(Zm00001d027710 / GRMZM2G122816)
DNA ref. GenBank:   AC190650.3 (90768..89361)
Protein sequence: ZmPrx132(Zm00001d027710 / GRMZM2G122816)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   443 (421)
PWM (Da):   %s   46538.46 (44372.2)  
PI (pH):   %s   4.73 (4.72) Peptide Signal:   %s   cut: 23 range:23-443
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDARLVFLLLLAAAASAPLASAQLSADFYKTSCPDAEKIIFDVVQ
KRFKADPGTAAGLLRLVFHDCFAN
GCDASILIDPMSNQASEKEAGPNVSVKGYDVIEEIKTELEKKCPNVVSCADIISVSARDSVKLTGGPEYAVPLGRRDSLVSNREDADNLPGPDIAVPKLIDEFDKQGFNVEEMVAMLGGG
HSIGVCRCFFIETDAAPIDPKYKKTISDACDGKDSGSVPMDSTSPNDLDGSYFGLVLEKKMPLTIDRLMGMDKKTEPIVKAMSDKTTDFVPIFAKAMEKLSVLKVLTGKEGEIRKTCSEF
NNPQNSSGSTSVIRISSIDPDQMAGLSQPGSSSRKVGPPPVEEETPAMVATEAAAKVPGGVVVSVGGGQQPAAQASGQEKVADTPGPKLRGSQETVNPAPVVSGAGAEEADKQEGAAALE
EKKKRNMAKLRGGA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1) and 10 ESTs. Also found in AC232222.3
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACGCCCGCCTCGTCTTCCTCCTCCTCCTCGCGGCCGCGGCGTCCGCGCCGCTGGCCTCCGCGCAGCTCTCGGCGGATTTCTACAAGACGTCGTGCCCCGACGCCGAGAAGATCATC
TTCGACGTCGTCCAGAAGCGGTTCAAAGCTGACCCCGGCACCGCCGCCGGCCTCCTCCGCCTCGTCTTCCACGACTGCTTCGCAAAC
ACGTACGTAACGTAATTAAGCTGCTTCGTCGTC
GTCAGACTCAGACATATGAACGTGTTTAATTTGTCTCGTCTCCAGGGCTGCGACGCGTCCATCCTGATCGACCCGATGTCGAACCAGGCCTCCGAGAAGGAGGCCGGCCCCAACGTCTCC
GTGAAGGGCTACGACGTGATCGAGGAGATCAAGACGGAGCTGGAGAAGAAGTGCCCGAACGTGGTGTCGTGCGCGGACATCATCTCGGTGAGCGCCCGCGACTCGGTGAAGCTGACGGGC
GGGCCCGAGTACGCGGTGCCCCTGGGACGGCGCGACTCGCTCGTGTCCAACCGCGAGGACGCCGACAACCTGCCGGGCCCGGACATCGCGGTGCCCAAGCTCATCGACGAGTTCGACAAG
CAGGGCTTCAACGTCGAGGAGATGGTCGCGATGCTGGGCGGCGGCCACAGCATCGGCGTCTGCAGGTGCTTCTTCATCGAGACCGACGCGGCGCCCATCGACCCCAAGTACAAGAAGACG
ATCAGCGACGCGTGCGACGGCAAGGACTCGGGCTCCGTCCCCATGGACTCCACCTCGCCCAACGACCTGGACGGGAGCTACTTCGGCCTGGTGCTGGAGAAGAAGATGCCGCTCACCATC
GACCGCCTGATGGGGATGGACAAGAAGACGGAGCCCATAGTGAAGGCCATGTCGGACAAGACCACCGACTTCGTCCCGATCTTCGCCAAGGCCATGGAGAAGCTCAGCGTGCTCAAGGTG
CTCACGGGGAAGGAAGGCGAGATCAGGAAGACGTGCTCCGAGTTCAACAACCCGCAGAACAGCAGCGGCAGCACGTCGGTGATACGGATCAGCTCCATCGACCCCGACCAGATGGCCGGG
CTGTCGCAGCCAGGGTCGTCGTCCAGGAAGGTGGGCCCTCCTCCCGTCGAGGAGGAAACACCCGCCATGGTGGCGACCGAGGCGGCCGCCAAGGTTCCGGGTGGTGTGGTCGTCAGCGTC
GGAGGAGGACAGCAGCCGGCCGCCCAAGCGTCAGGCCAGGAGAAGGTGGCGGATACGCCCGGCCCCAAGCTCCGCGGAAGCCAGGAGACTGTGAACCCGGCCCCGGTGGTGTCCGGCGCC
GGCGCCGAGGAGGCCGACAAGCAGGAGGGGGCGGCGGCCCTGGAGGAGAAGAAGAAGAGGAACATGGCCAAACTCCGCGGCGGTGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACGCCCGCCTCGTCTTCCTCCTCCTCCTCGCGGCCGCGGCGTCCGCGCCGCTGGCCTCCGCGCAGCTCTCGGCGGATTTCTACAAGACGTCGTGCCCCGACGCCGAGAAGATCATC
TTCGACGTCGTCCAGAAGCGGTTCAAAGCTGACCCCGGCACCGCCGCCGGCCTCCTCCGCCTCGTCTTCCACGACTGCTTCGCAAAC
GGCTGCGACGCGTCCATCCTGATCGACCCGATG
TCGAACCAGGCCTCCGAGAAGGAGGCCGGCCCCAACGTCTCCGTGAAGGGCTACGACGTGATCGAGGAGATCAAGACGGAGCTGGAGAAGAAGTGCCCGAACGTGGTGTCGTGCGCGGAC
ATCATCTCGGTGAGCGCCCGCGACTCGGTGAAGCTGACGGGCGGGCCCGAGTACGCGGTGCCCCTGGGACGGCGCGACTCGCTCGTGTCCAACCGCGAGGACGCCGACAACCTGCCGGGC
CCGGACATCGCGGTGCCCAAGCTCATCGACGAGTTCGACAAGCAGGGCTTCAACGTCGAGGAGATGGTCGCGATGCTGGGCGGCGGCCACAGCATCGGCGTCTGCAGGTGCTTCTTCATC
GAGACCGACGCGGCGCCCATCGACCCCAAGTACAAGAAGACGATCAGCGACGCGTGCGACGGCAAGGACTCGGGCTCCGTCCCCATGGACTCCACCTCGCCCAACGACCTGGACGGGAGC
TACTTCGGCCTGGTGCTGGAGAAGAAGATGCCGCTCACCATCGACCGCCTGATGGGGATGGACAAGAAGACGGAGCCCATAGTGAAGGCCATGTCGGACAAGACCACCGACTTCGTCCCG
ATCTTCGCCAAGGCCATGGAGAAGCTCAGCGTGCTCAAGGTGCTCACGGGGAAGGAAGGCGAGATCAGGAAGACGTGCTCCGAGTTCAACAACCCGCAGAACAGCAGCGGCAGCACGTCG
GTGATACGGATCAGCTCCATCGACCCCGACCAGATGGCCGGGCTGTCGCAGCCAGGGTCGTCGTCCAGGAAGGTGGGCCCTCCTCCCGTCGAGGAGGAAACACCCGCCATGGTGGCGACC
GAGGCGGCCGCCAAGGTTCCGGGTGGTGTGGTCGTCAGCGTCGGAGGAGGACAGCAGCCGGCCGCCCAAGCGTCAGGCCAGGAGAAGGTGGCGGATACGCCCGGCCCCAAGCTCCGCGGA
AGCCAGGAGACTGTGAACCCGGCCCCGGTGGTGTCCGGCGCCGGCGCCGAGGAGGCCGACAAGCAGGAGGGGGCGGCGGCCCTGGAGGAGAAGAAGAAGAGGAACATGGCCAAACTCCGC
GGCGGTGCCTAG

Retrieve as FASTA