Entry information : ZmPrx136(Zm00001d016443 / GRMZM2G160327)
Entry ID 6698
Creation 2009-04-11 (Christophe Dunand)
Last sequence changes 2009-04-11 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-02 (Christophe Dunand)
Peroxidase information: ZmPrx136(Zm00001d016443 / GRMZM2G160327)
Name ZmPrx136(Zm00001d016443 / GRMZM2G160327)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx136
start..stop
S start..stop
SbPrx82 522 0 29..330 31..330
SiPrx75 506 0 33..328 29..322
TaPrx183-1D 468 9.08e-167 5..328 63..381
OsPrx32 463 1.04e-165 14..328 17..326
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6698' 'join(158822364..158822594,158822699..158822887,158823377..158823949)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 158822364..158822594 229 N° 2 158822699..158822887 187 N° 3 158823377..158823949 571  
join(158822364..158822594,158822699..158822887,158823377..158823949)


exon

Literature and cross-references ZmPrx136(Zm00001d016443 / GRMZM2G160327)
DNA ref. GenBank:   AC198130.3 (163404..164989)
Cluster/Prediction ref. UniGene:   Zm.34268
Protein sequence: ZmPrx136(Zm00001d016443 / GRMZM2G160327)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (308)
PWM (Da):   %s   34367.59 (32298.4) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.22 (8.41) Peptide Signal:   %s   cut: 32 range:23-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAPPAAEAALLLLLALLALAAVALRRGDALSLDLYDVTCPEVE
AAVTAAVRQAMANDRTVAAGLLRMHFHDCFVR
GCDGSVLLDSTATVTAEKDGPPNASLHAFYVIDNAKRAVEALCPGVVSCADILALAARDAVALSGGPWWVVPVGRRDGRVSLANETTAALPGPTASFDQLKQAFHGRGLSTKDLVALSGA
HTLGFAHCSSFQNRILRAQQGVAAADDPSLSPSFAAALRRACPANNTVRAAGSALDATSAAFDNTYYRMLQAGRGLLSSDEALLTHPKTRAFVALYAASQEAFFRAFTKSMLRMAGLNGG
QEVRANCRRVNPS*

Retrieve as FASTA  
Remarks Complete Sequence from genomic (chromo 5, introns 1 and 2) and 5 ESTs. Incorrect prediction from Phytozome (tiny splicing error intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGGCGCCTCCTGCCGCAGAGGCAGCTCTTCTTCTCCTCCTAGCATTACTGGCACTCGCCGCGGTGGCTCTGAGACGCGGCGATGCGCTGAGCCTGGATTTGTACGACGTGACC
TGCCCGGAGGTGGAGGCGGCGGTGACGGCGGCCGTGCGGCAGGCCATGGCCAACGACCGCACAGTGGCGGCCGGACTCCTCCGAATGCATTTCCACGACTGCTTCGTGAGG
GGGTAATAA
TTTCCTCCTCTTATTCTTGTTGTTGAATCTATCATTGCATTATTGGTCTGCTGTCCTCTGAATCCATCCGCCCGCCCGCCCGGCCGGCCGGCAGCAGGGCTGCGACGGCTCCGTTCTCCT
GGACTCCACGGCCACCGTGACGGCGGAGAAGGACGGCCCGCCCAACGCGTCGCTGCACGCCTTCTACGTCATCGACAACGCCAAGCGTGCCGTGGAGGCCCTCTGCCCCGGCGTCGTCTC
CTGCGCCGACATCCTCGCCCTCGCCGCAAGGGACGCCGTCGCGCTG
TGGTATGTATATTCTGCTGGAGTGATAGTAGATAGATGATGATGCAATGCAATAGATGCGATCGATCGAGAAGA
ACGATGCTGCGCTTGTTGAGAGATGAGGACGATGCTAGTAGCTAACACGGCAGGTCAGCAGCCTCTCTCATGCATGTTCGGAACGAACGCCCATCCGGAGTCACGTGCTTGCGTCTCTAG
CTACGACAGCCATGGATACCGCCTGCTGCATCGAGCGAGCTGTCACTTGTGGTGATCACGTGCTCGATGTGTCTCGATCCTCGAGCATAAAGTGCTGCTGGCCGGCTGCCCCGCATCCGC
ATGCAAGCAGCAGCAGCAGCAGGGCCTGGTTGTCGTACGTGCACGCATCATGCATACATGATCGGACTATCCTCAACTAGCTAGCAGTAGCACAGTAGTACATTTTTTGTATTATTATCT
TTTGCATTTTGTGCATTAATTAATTACCTCCTGATCGGCCATGCACGTACGATGCAGTCCGGTGGTCCGTGGTGGGTGGTGCCCGTGGGGCGGCGGGACGGGCGCGTGTCCCTGGCCAAC
GAGACCACGGCGGCGCTGCCGGGGCCGACGGCCAGCTTCGACCAGCTGAAGCAGGCGTTCCACGGCCGCGGGCTGTCCACCAAGGACCTGGTGGCGCTGTCGGGCGCCCACACGCTGGGC
TTCGCGCACTGCTCCTCCTTCCAGAACCGCATCCTCCGAGCCCAGCAGGGCGTCGCCGCCGCCGACGACCCTTCCCTCAGCCCCTCCTTCGCCGCCGCCCTTCGCCGTGCGTGCCCCGCC
AACAACACCGTCCGCGCCGCCGGCTCCGCCCTGGACGCCACCTCCGCGGCCTTCGACAACACCTACTACCGGATGCTGCAGGCCGGCCGGGGCCTGCTCTCCTCCGACGAGGCGCTGCTC
ACGCACCCCAAGACGCGCGCCTTTGTCGCGCTCTACGCCGCGTCGCAGGAGGCATTCTTCAGGGCCTTTACAAAATCCATGCTGCGGATGGCCGGCCTCAACGGAGGCCAAGAGGTGCGA
GCCAACTGCAGGCGAGTTAACCCATCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGGCGCCTCCTGCCGCAGAGGCAGCTCTTCTTCTCCTCCTAGCATTACTGGCACTCGCCGCGGTGGCTCTGAGACGCGGCGATGCGCTGAGCCTGGATTTGTACGACGTGACC
TGCCCGGAGGTGGAGGCGGCGGTGACGGCGGCCGTGCGGCAGGCCATGGCCAACGACCGCACAGTGGCGGCCGGACTCCTCCGAATGCATTTCCACGACTGCTTCGTGAGG
GGCTGCGAC
GGCTCCGTTCTCCTGGACTCCACGGCCACCGTGACGGCGGAGAAGGACGGCCCGCCCAACGCGTCGCTGCACGCCTTCTACGTCATCGACAACGCCAAGCGTGCCGTGGAGGCCCTCTGC
CCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCAAGGGACGCCGTCGCGCTG
TCCGGTGGTCCGTGGTGGGTGGTGCCCGTGGGGCGGCGGGACGGGCGCGTGTCCCTGGCC
AACGAGACCACGGCGGCGCTGCCGGGGCCGACGGCCAGCTTCGACCAGCTGAAGCAGGCGTTCCACGGCCGCGGGCTGTCCACCAAGGACCTGGTGGCGCTGTCGGGCGCCCACACGCTG
GGCTTCGCGCACTGCTCCTCCTTCCAGAACCGCATCCTCCGAGCCCAGCAGGGCGTCGCCGCCGCCGACGACCCTTCCCTCAGCCCCTCCTTCGCCGCCGCCCTTCGCCGTGCGTGCCCC
GCCAACAACACCGTCCGCGCCGCCGGCTCCGCCCTGGACGCCACCTCCGCGGCCTTCGACAACACCTACTACCGGATGCTGCAGGCCGGCCGGGGCCTGCTCTCCTCCGACGAGGCGCTG
CTCACGCACCCCAAGACGCGCGCCTTTGTCGCGCTCTACGCCGCGTCGCAGGAGGCATTCTTCAGGGCCTTTACAAAATCCATGCTGCGGATGGCCGGCCTCAACGGAGGCCAAGAGGTG
CGAGCCAACTGCAGGCGAGTTAACCCATCATGA

Retrieve as FASTA