Entry information : AruPrx05 (HRPE5 / HRP_E5)
Entry ID 67
Creation 2006-09-05 (Christophe Dunand)
Last sequence changes 2014-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-05-05 (Christophe Dunand)
Peroxidase information: AruPrx05 (HRPE5 / HRP_E5)
Name (synonym) AruPrx05 (HRPE5 / HRP_E5)
Class Class III peroxidase    [Orthogroup: Prx047]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx05
start..stop
S start..stop
NoffPrx22-2A 613 0 1..333 1..335
AruPrx23 608 0 1..333 1..335
NoffPrx22-2B 597 0 1..333 1..335
AlyPrx22 589 0 1..333 1..335
Gene structure Fichier Exons


exon

Literature and cross-references AruPrx05 (HRPE5 / HRP_E5)
Literature REFERENCE 1 Morita,Y. et al Primary and crystal structures of horseradish peroxidase isozyme E5.
REFERENCE 2 Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome. BMC Genomics 15 (1), 227 (2014)
Protein ref. UniProtKB:   K7ZW57  P59121
DNA ref. GenBank:   HE963808.1
Protein sequence: AruPrx05 (HRPE5 / HRP_E5)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (306)
PWM (Da):   %s   36269.44 (33545.1) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.56 (8.76) Peptide Signal:   %s   cut: 28 range:28-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVVSPFFSCSAMGALILGCLLLQASNAQLRPDFYSRTCPSVFNIIKNVIVDELQTDPRIAASILRLHFHDCFVRGCDASILLDTSKSFRTEKDAAPNVNSARGFNVIDRMKTALERACPR
TVSCADILTIASQISVLLSGGPSWAVPLGRRDSVEAFFDLANTALPSPFFTLAQLKKAFADVGLNRPSDLVALSGGHTFGRARCLFVTARLYNFNGTNRPDPTLNPSYLADLRRLCPRNG
NGTVLVNFDVMTPNTFDNQFYTNLRNGKGLIQSDQELFSTPGADTIPLVNLYSSNTLSFFGAFADAMIRMGNLRPLTGTQGEIRQNCRVVNSR

Retrieve as FASTA  
Remarks Complete seqyuence from genomic (3 introns) and mature sequence protein.
DNA
Send to BLAST
CDS
Send to BLAST