Entry information : ZmPrx142
Entry ID 6704
Creation 2009-04-11 (Christophe Dunand)
Last sequence changes 2009-04-11 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx142
Name ZmPrx142
Class Class III peroxidase    [Orthogroup: Prx032]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Endosperm
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx142
start..stop
S start..stop
ZmPrx105 622 0 1..326 1..325
SbPrx10 591 0 1..326 1..327
PviPrx02 578 0 1..326 1..324
SiPrx162 566 0 25..326 24..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 113826138..113826365 228 N° 2 113825807..113825986 180 N° 3 113825293..113825455 163 N° 4 113823644..113824053 410
complement(join(113823644..113824053,113825293..113825455,113825807..113825986,1 13826138..113826365))


exon

Literature and cross-references ZmPrx142
Literature Verza,N.C., Silva,T.R., Cord-Neto,G., Nogueira,F.T.S., Fisch,P.H., De Rosa,V.E. Jr., Rebello,M.M., Vettore,A.L., da Silva,F.R. and Arruda,P. Endosperm-preferred expression of maize genes as revealed by transcriptome-wide analysis of expressed sequence tags. Plant Mol Biol 59 (2), 363-374 (2005).
DNA ref. GenBank:   AC196200.3 (28151..30872)
EST ref. GenBank:   CO464107.1 [5' end]   CO458751.1 [3' end]
Cluster/Prediction ref. GenBank:   86057
Protein sequence: ZmPrx142
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (307)
PWM (Da):   %s   34951.27 (33152.3)  
PI (pH):   %s   5.94 (5.94) Peptide Signal:   %s   cut: 28 range:20-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQPACSGAALLAAFIAVLAYSAARCRGQLADNYYAGKCGNFSVEAIIRDAVKARLAWDKRMVAGLLHLQFHDCFVAGCDASILLDGPDTEKTAVQNSGIFGYDFIDDVKAALERVCPGVVSCADIIIAATRDAVGMCGGPSYQVQLGRRDGMVSQASMASILPGPNVDVPTAIDLFARKGLNSFEMVSLMGAHTVGVTHCSVIHDRLFNFNGTGSPDPAMDPMYVWILTTYACPRGQAFDNIVYLDDPSSILLVDRSYYSQIMKRHGVLSVDQALGDSSATAWMVKFLATTDFFPSMFSYALNKLAALDVLTGTDGEIRKSCRRTN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 3 introns) and 4 ESTs. Cultivar="F-352 near isogenic line" and "B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGCCGGCCTGCTCCGGCGCCGCGCTTCTCGCCGCCTTCATCGCCGTGCTGGCGTATTCGGCCGCGCGCTGCCGCGGCCAGCTCGCCGACAACTACTACGCCGGCAAGTGCGGCAAC
TTCAGCGTGGAGGCCATCATCCGGGACGCCGTCAAGGCCCGCCTCGCGTGGGACAAGCGGATGGTCGCCGGCCTCCTCCACCTGCAGTTCCACGACTGCTTCGTCGCC
GTACGTAGGCAA
TAAACACCACCAGCAGTGCCAGCTGCTAGCTATTAGCTATAGCTTCCTTTCATCAGTATCGTATCATCTATCGACGACGATATATCCATGAGTTCCATTACTGATTTATATCTCTTGCTG
CTGCTTGTATGCAATGAAGGGGTGCGACGCGTCCATCCTGCTGGACGGGCCTGACACGGAGAAGACGGCGGTGCAGAACAGCGGCATCTTCGGCTACGACTTCATCGACGACGTGAAGGC
GGCGCTCGAGAGAGTTTGCCCCGGCGTCGTCTCCTGCGCTGACATCATCATCGCCGCGACAAGGGACGCCGTTGGCATG
GTGAGTCACCCTGCCCGGCCCGGCCCTACCTACGAGCTACA
TGTACTACGTGAACAAGCAATAATGCCGATTGGTTTTCTTTCTGAAGAATCGCAATGTCGAGCTGAATGGCGATGATTGACTTCATCCGCTGCTCTTACCTTTTGACATATGATGATTTA
TCTTTTGGTTTTGCTAAGAGCGAGCTGGCAACGGCTTCGTTCGATTTTTAATTATTCATTACTAGGCAGGCTATAAATACCACATTGTGAATCCGTTTATTGTTGCTTTAATACTTAAAT
ACTGGTTACAAATGACGAATTAAGTGACGATTTATCTGCGCTGTGAACGAATTATTCAATGCAAGTCCAGTGCGGGGGGCCGAGCTACCAAGTGCAGCTGGGCAGAAGGGACGGCATGGT
GTCGCAGGCGTCCATGGCGAGCATTCTGCCGGGCCCCAACGTCGACGTCCCCACCGCCATCGATCTGTTCGCGCGGAAGGGCCTCAACAGCTTCGAGATGGTCAGCCTCATGG
GTACGTG
TACGTCCGTCGCCGTCGTCTATGCTACGGCGTTTTTTCTTTTTAACACAGAAAACAAGACACATAAAAAGCTAGCTATAGCTAAAGATCAATATAATACGTCGTCGCGGTTTTACTGGTC
AGTATCAGTACAAATGGTGTTAGAAAGTTTTACCATGACCCACGTGCATTGTTCTCTTCGGCAACATGAAGCAGATCGACTGGTTTTATATATAGCGAATAAACTAGCGTCTTTTGACCT
GGAACACACAGCTAAGCGTATCGATTCAGTGTGCATATATCAAGGCAGCTCAACACATGGAATATCGCGTACATGGTACACCAGTGTTGGCACGCATAAAATAAACAGTTAGTATATATT
TATTGAGTTAGTTTGCTGGTGGTCTAACCCTAACGTTACTATGTACTACTATATTAAATGTGATCTTGGTAGAGGTATATTTTAATCATATTAATTACGTTATTTCGCATTCCAATATGT
ACCCCCATGCATGCACGATGATCATCACTACCCCACCAGCTCCTCATCCAACCGTTAGGAATCGCACTGATCAAATGCTGAATAAGTTGTTCCGATCGAGGTCTCCCACTTGGTCCATCT
CGATCGATGAGTGTTAAATTTGCATTTGATAATTAAGTTAATTAATCGTCGTCACGTCCAGCACACACATATATAAGCATCATCAATACAATAAAAATGCAACTGTGTGCTTGCAGTGCA
TTGTTGTTCGTGTTCCGTGTACATCTCTCGTGTAGCTTTAAAACTTCTTTATTTTCCATCTAGTACATATATACTCCCTCCGGTGCAGTAAAAGAAGTCATCCTGCGCGTGAGCGAGAGT
GCACAAAAGAAGTCGTAGCACGCGTGGGTCTGGAATTTTTGACGTCGCTGCCCCTGAGTAATTGCATCGGGAAAAAAAAAGCTACGCTCAAGGGGAATCGAGAATGAGACCTCCAGTCTA
GAATGTCTTGAGAGGTGCTGCAGCAACCAATCAGACTTGATTGTTTTGGTGATGTTAATGCACCCATATCACTATTTAATAAGAGCAAACATGGAAAACTACATGATAATTAATCACTCC
TTGGTATGCATAATCATGTCTTAAACGACTACCTTTACTGCACCGGAGGGAGTACATGCTCACGAACTATATATACTGATGAAATTTGTAAGCGCCAGTAGTTTTGCCGTACAAATAACC
CGGCCCTGCGCCGTCGTTCCCTTTTCTCGCAGGCGCGCACACGGTGGGGGTGACGCACTGCTCGGTGATCCACGACCGGCTGTTCAACTTCAACGGCACCGGGTCGCCGGACCCGGCCAT
GGACCCGATGTACGTGTGGATCCTGACGACGTACGCGTGCCCCAGGGGCCAGGCCTTCGACAACATCGTCTACCTCGACGACCCCTCCAGCATCCTGCTCGTCGACCGGAGCTACTACTC
CCAGATCATGAAGCGCCACGGCGTGCTGTCCGTGGACCAGGCCCTCGGCGACAGCAGCGCCACCGCGTGGATGGTCAAGTTCCTCGCCACCACCGACTTCTTCCCCTCCATGTTCAGCTA
CGCGCTCAACAAGCTCGCCGCGCTCGACGTCCTCACCGGCACCGACGGCGAGATCAGGAAGAGCTGCCGGAGGACCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGCCGGCCTGCTCCGGCGCCGCGCTTCTCGCCGCCTTCATCGCCGTGCTGGCGTATTCGGCCGCGCGCTGCCGCGGCCAGCTCGCCGACAACTACTACGCCGGCAAGTGCGGCAAC
TTCAGCGTGGAGGCCATCATCCGGGACGCCGTCAAGGCCCGCCTCGCGTGGGACAAGCGGATGGTCGCCGGCCTCCTCCACCTGCAGTTCCACGACTGCTTCGTCGCC
GGGTGCGACGCG
TCCATCCTGCTGGACGGGCCTGACACGGAGAAGACGGCGGTGCAGAACAGCGGCATCTTCGGCTACGACTTCATCGACGACGTGAAGGCGGCGCTCGAGAGAGTTTGCCCCGGCGTCGTC
TCCTGCGCTGACATCATCATCGCCGCGACAAGGGACGCCGTTGGCATG
TGCGGGGGGCCGAGCTACCAAGTGCAGCTGGGCAGAAGGGACGGCATGGTGTCGCAGGCGTCCATGGCGAGC
ATTCTGCCGGGCCCCAACGTCGACGTCCCCACCGCCATCGATCTGTTCGCGCGGAAGGGCCTCAACAGCTTCGAGATGGTCAGCCTCATGG
GCGCGCACACGGTGGGGGTGACGCACTGC
TCGGTGATCCACGACCGGCTGTTCAACTTCAACGGCACCGGGTCGCCGGACCCGGCCATGGACCCGATGTACGTGTGGATCCTGACGACGTACGCGTGCCCCAGGGGCCAGGCCTTCGAC
AACATCGTCTACCTCGACGACCCCTCCAGCATCCTGCTCGTCGACCGGAGCTACTACTCCCAGATCATGAAGCGCCACGGCGTGCTGTCCGTGGACCAGGCCCTCGGCGACAGCAGCGCC
ACCGCGTGGATGGTCAAGTTCCTCGCCACCACCGACTTCTTCCCCTCCATGTTCAGCTACGCGCTCAACAAGCTCGCCGCGCTCGACGTCCTCACCGGCACCGACGGCGAGATCAGGAAG
AGCTGCCGGAGGACCAACTGA

Retrieve as FASTA