Entry information : PcKat01
Entry ID 6715
Creation 2009-04-29 (Christophe Dunand)
Last sequence changes 2009-04-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Catherine Mathe (Scipio))
Peroxidase information: PcKat01
Name PcKat01
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcKat01
start..stop
S start..stop
PcarKat01 878 0 1..510 1..510
PplKat01 789 0 1..506 1..506
LbiKat01 756 0 1..506 1..516
CcinKat01 752 0 1..506 1..516
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 885828..885951 124 N° 2 885721..885779 59 N° 3 885491..885662 172 N° 4 884989..885440 452
N° 5 884468..884936 469 N° 6 884288..884413 126 N° 7 884102..884235 134  
complement(join(884102..884235,884288..884413,884468..884936,884989..885440,8854 91..885662,885721..885779,885828..885951))


exon

Literature and cross-references PcKat01
DNA ref. JGI genome:   scaffold_12 (885951..884102)
mRNA ref. JGI transcript:   124398
Protein sequence: PcKat01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   511
PWM (Da):   %s   57755.06  
PI (pH):   %s   7.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPTKRALQAQDNALFVASNGAPVAEPYAAQRIGRNGPLLLQDFNLIDLLSHFDRERIPERVHAKGAGAHGFFECTENVTDLTCASFLSQPGKKSPLTIRFSTVGGESGSADSARDPRGFAMKIKTDEGNLDWVFNNTPVFFIRDPTKFPHFIHTQKRDPETHLKDPDMFWDYLSQNPESIHQVMILFSDRGTPYGYHHMHGYSGHTYKFVNKEGKFHYVQIHFRKKGGFKTIDNDTATKLAGENPDYGIEALHNDIEAGNFPEWDVYQTMTPEQAEKFRYNVLDLTKIWPHKEFPLRKIGRMVLDRNVENYFAEIEQAAFSPSHTVPGVEPSADPVLQSRLFSYPDTHRHRLGVNYQQLPVNKPVVPVANFQRDGPMAFDNQGTRPNYQSSLVPLTYKAKPYDIADHETWLGAATTDLSFITELDFEQPRALWQKVFDDKQKNALIYNLKGHLGSVKSPVVKARQLSVFAAVDQEIADRLCREIGHPPVKPMEVAPAAKAYRFQYSAAN

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGACCAAGCGCGCTCTCCAGGCTCAGGACAATGCCCTCTTCGTCGCCTCTAATGGCGCCCCTGTCGCAGAGCCGTACGCTGCTCAGCGCATTGGTCGCAACGGTCCACTCCTCCTC
CAGG
GTAAGTTGTTGTCGGTTCACTGTAGATATCATACTGACTAGCCGACAGACTTCAACCTGATTGACCTTCTGTCGCACTTCGACAGAGAGCGTATCCCAGAGCGCGTCGTATGTGTC
TAATCTCCCTCCGACCACAACATAGCTCGTTCTCATCGCCATTATATAGGTCCACGCTAAGGGCGCAGGAGCTCACGGTTTCTTCGAATGCACTGAGAACGTCACCGACCTCACTTGCGC
TTCGTTCTTGAGCCAGCCCGGAAAGAAGTCTCCTCTCACCATCCGTTTCTCGACGGTCGGTGGCGAGTCCGGTTCCGCCGACTCGGCCCGTGATCCTCGAG
GTATGCCTCTTTCTGTATC
AGTTCGGAGAACTTGGCTGACGTCCAGGTAGGCTTTGCCATGAAGATCAAGACCGATGAGGGCAACCTTGACTGGGTATTCAACAACACGCCTGTCTTCTTTATCCGCGATCCGACGAAG
TTCCCGCACTTCATTCACACCCAAAAGCGTGACCCGGAGACCCATCTCAAGGACCCTGACATGTTCTGGGACTACCTGTCGCAGAACCCGGAGTCGATCCACCAGGTCATGATCCTCTTC
TCTGACCGCGGAACCCCTTACGGCTACCACCACATGCACGGCTATTCGGGACACACCTACAAGTTTGTCAACAAGGAAGGCAAGTTCCACTACGTTCAGATTCACTTCCGCAAGAAGGGT
GGCTTCAAGACCATTGATAACGACACTGCGACTAAGCTCGCTGGGGAGAACCCCGACTATGGTATCGAGGCTCTCCACAACGACATCGAAGCCGGCAACTTCCCCGAATGGGACGTCTAC
GTC
GTACGTACCTTTTACTGTGATAACCGCCTCGTCTCACACATCACCTCTCCAGCAAACTATGACTCCCGAGCAGGCTGAGAAGTTCCGCTACAACGTTCTCGACCTCACCAAGATCTG
GCCGCACAAGGAGTTCCCTCTCCGCAAGATCGGTCGGATGGTTCTCGACCGCAACGTCGAGAACTACTTCGCCGAGATCGAGCAGGCAGCCTTCTCGCCTTCGCATACTGTCCCCGGCGT
TGAGCCGTCCGCGGATCCCGTCCTGCAGTCCCGTCTCTTCTCTTACCCCGACACCCACCGCCACCGTCTCGGCGTCAACTACCAGCAGCTGCCGGTCAACAAGCCTGTCGTCCCCGTTGC
TAACTTCCAGCGCGACGGCCCGATGGCGTTCGACAACCAGGGCACGCGCCCGAACTACCAGAGTTCGCTCGTCCCGCTGACGTACAAGGCCAAGCCGTACGACATCGCTGACCACGAGAC
GTGGCTTGGTGCTGCCACCACCGACCTCAGCTTCATCACTGAGC
GTGAGTCTCCTCGTCATCGTGTCTGCGGACGACGCTGACTCTCGTTGCCCACAGTCGACTTCGAGCAGCCCCGTGC
GCTCTGGCAGAAGGTCTTCGACGACAAGCAGAAGAACGCGCTCATCTACAACCTCAAGGGCCACCTTGGCTCTGTCAAGAGCCCCGTCGTCAAGGCCAGGCAGC
GTAAGTCCTACATGCA
CCATTGTTCTCGTGCACATTCTTACTTGCGATATAGTCTCCGTCTTCGCTGCGGTCGACCAGGAGATTGCGGACCGTCTCTGCCGCGAAATTGGTCACCCACCTGTCAAGCCTATGGAAG
TCGCACCGGCTGCGAAGGCTTACCGCTTCCAGTACTCCGCCGCCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGACCAAGCGCGCTCTCCAGGCTCAGGACAATGCCCTCTTCGTCGCCTCTAATGGCGCCCCTGTCGCAGAGCCGTACGCTGCTCAGCGCATTGGTCGCAACGGTCCACTCCTCCTC
CAGG
ACTTCAACCTGATTGACCTTCTGTCGCACTTCGACAGAGAGCGTATCCCAGAGCGCGTCGTCCACGCTAAGGGCGCAGGAGCTCACGGTTTCTTCGAATGCACTGAGAACGTCACC
GACCTCACTTGCGCTTCGTTCTTGAGCCAGCCCGGAAAGAAGTCTCCTCTCACCATCCGTTTCTCGACGGTCGGTGGCGAGTCCGGTTCCGCCGACTCGGCCCGTGATCCTCGAG
GCTTT
GCCATGAAGATCAAGACCGATGAGGGCAACCTTGACTGGGTATTCAACAACACGCCTGTCTTCTTTATCCGCGATCCGACGAAGTTCCCGCACTTCATTCACACCCAAAAGCGTGACCCG
GAGACCCATCTCAAGGACCCTGACATGTTCTGGGACTACCTGTCGCAGAACCCGGAGTCGATCCACCAGGTCATGATCCTCTTCTCTGACCGCGGAACCCCTTACGGCTACCACCACATG
CACGGCTATTCGGGACACACCTACAAGTTTGTCAACAAGGAAGGCAAGTTCCACTACGTTCAGATTCACTTCCGCAAGAAGGGTGGCTTCAAGACCATTGATAACGACACTGCGACTAAG
CTCGCTGGGGAGAACCCCGACTATGGTATCGAGGCTCTCCACAACGACATCGAAGCCGGCAACTTCCCCGAATGGGACGTCTACGTC
CAAACTATGACTCCCGAGCAGGCTGAGAAGTTC
CGCTACAACGTTCTCGACCTCACCAAGATCTGGCCGCACAAGGAGTTCCCTCTCCGCAAGATCGGTCGGATGGTTCTCGACCGCAACGTCGAGAACTACTTCGCCGAGATCGAGCAGGCA
GCCTTCTCGCCTTCGCATACTGTCCCCGGCGTTGAGCCGTCCGCGGATCCCGTCCTGCAGTCCCGTCTCTTCTCTTACCCCGACACCCACCGCCACCGTCTCGGCGTCAACTACCAGCAG
CTGCCGGTCAACAAGCCTGTCGTCCCCGTTGCTAACTTCCAGCGCGACGGCCCGATGGCGTTCGACAACCAGGGCACGCGCCCGAACTACCAGAGTTCGCTCGTCCCGCTGACGTACAAG
GCCAAGCCGTACGACATCGCTGACCACGAGACGTGGCTTGGTGCTGCCACCACCGACCTCAGCTTCATCACTGAGC
TCGACTTCGAGCAGCCCCGTGCGCTCTGGCAGAAGGTCTTCGAC
GACAAGCAGAAGAACGCGCTCATCTACAACCTCAAGGGCCACCTTGGCTCTGTCAAGAGCCCCGTCGTCAAGGCCAGGCAGC
TCTCCGTCTTCGCTGCGGTCGACCAGGAGATTGCGGAC
CGTCTCTGCCGCGAAATTGGTCACCCACCTGTCAAGCCTATGGAAGTCGCACCGGCTGCGAAGGCTTACCGCTTCCAGTACTCCGCCGCCAACTAA

Retrieve as FASTA