Entry information : PcKat02
Entry ID 6716
Creation 2009-04-29 (Christophe Dunand)
Last sequence changes 2009-04-29 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2015-12-11 (Catherine Mathe)
Peroxidase information: PcKat02
Name PcKat02
Class Catalase    [Orthogroup: Kat003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcKat02
start..stop
S start..stop
PcarKat02 1021 0 1..554 1..541
PplKat02 727 0 4..554 29..571
PinvKat02 577 0 4..527 12..530
SbreKat02 561 0 4..527 12..530
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2191467..2191668 202 N° 2 2191726..2191798 73 N° 3 2191852..2191908 57 N° 4 2192002..2192078 77
N° 5 2192132..2192204 73 N° 6 2192253..2192293 41 N° 7 2192342..2192394 53 N° 8 2192445..2192485 41
N° 9 2192537..2192659 123 N° 10 2192709..2192769 61 N° 11 2192826..2193004 179 N° 12 2193058..2193126 69
N° 13 2193193..2193299 107 N° 14 2193358..2193392 35 N° 15 2193446..2193479 34 N° 16 2193533..2193660 128
N° 17 2193712..2193815 104 N° 18 2193870..2194077 208  
join(2191467..2191668,2191726..2191798,2191852..2191908,2192002..2192078,2192132 ..2192204,2192253..2192293,2192342..2192394,2192445..2192485,2192537..2192659,21 92709..2192769,2192826..2193004,2193058..2193126,2193193..2193299,2193358..21933 92,2193446..2193479,2193533..2193660,2193712..2193815,2193870..2194077)


exon

Literature and cross-references PcKat02
Literature Martinez,D., Larrondo,L.F., Putnam,N., Gelpke,M.D., Huang,K., Chapman,J., Helfenbein,K.G., Ramaiya,P., Detter,J.C., Larimer,F., Coutinho,P.M., Henrissat,B., Berka,R., Cullen,D. and Rokhsar,D. Genome sequence of the lignocellulose degrading fungus Phanerochaete chrysosporium strain RP78. Nat. Biotechnol. 22 (6), 695-700 (2004).
DNA ref. JGI genome:   scaffold_4 (2191467..2194077)
mRNA ref. JGI transcript:   128306
Protein sequence: PcKat02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   554 (535)
PWM (Da):   %s   61463.98 (59684.0)  
PI (pH):   %s   7 (6.77) Peptide Signal:   %s   cut: 20 range:20-554
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARAALALALALACAAARAQDAYTFDINAGVDVQAATDAEPAPQLTFATEAGVPYTHPYDAQKIGSDGPLLLQDQHLVETLAHFVRERIPERVVHAKAAGAHGYFEVTNAECVHETLRGHASVLILIQNGLKTPIVRISTVGGEMGSADTARDPRGFSIKFRTRKGIWDLVMNTPVFFIRDPAKFPHFIHTQKRDPQTHLRDDMFWDYLSSNPESLYQVMRLFSDLGTPKGVRHLNAWTGHSYRWVKSDGSWVYVKLYCETMQGVQNFTNAEATAIAGANPDYAQQDLFEAIENKTYPGWVMYAQVLTPQQAERFKYNVLDLKDWGFDDVPRHEIGRFYLTQNPANYFAEIEQAAFSPGRIVPGWEPSTDPVLQARLFSYDAQRYRLGVNYQLPVNAPTSPVANFQRDGHMAFSNQGSRPNYLSTLQKINLPPLPYVQDTHQRWGGAVKSLSEVTAIDFDWPQRFWKSLSEQDQKNLIGNVVGHLGTVKSVSVRQRQVALFALVDPALGKAVADGVGVTVPSPLPSFPAGPTWLNTTKPSDSSTLNY

Retrieve as FASTA  
Remarks Complete sequence from genomic (18 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCGTGCAGCACTTGCTCTTGCGCTCGCACTCGCGTGCGCCGCGGCGCGCGCGCAGGACGCGTACACGTTCGATATCAACGCGGGCGTCGACGTCCAGGCCGCGACCGACGCGGAG
CCTGCGCCGCAGCTCACGTTTGCGACCGAGGCCGGCGTGCCGTACACGCACCCGTACGACGCACAGAAGATTGGCAGCGACG
GTATGCACATCGCGGCGGCGTGCCTGCTCTCAGGGCGG
TGCTGATGCCGGGAACCAGGACCTCTCCTCCTCCAGGACCAGCACCTCGTCGAGACCCTCGCGCACTTCGTGCGTGAGCGTATTCCGGAGCGGTGAGTGGCCAGCAGTCCCCGCGACGTC
GAAGGCGTGCTGACCAAGACGGTAGTGTTGTGCACGCAAAGGCCGCCGGTGCACATGGGTACTTTGAAGTTACGAATGCAGAGTTTGCGAAAAACTACACTATCATGTAAGTCTCCAATC
CTGCCCGATCCGTGCTCCTATTGATAGCCCATCTTCTAGGGACGTCTTCTCGGAGGTGCGTGCATGAGACCTTGCGCGGTCATGCTTCGGTCCTCATTCTTATTCAGAATGGCTTGAAAA
CCCCGATCACAG
GTGTGTGTGCCTGGTCATCCTGCTAGCGGGCGCAAGTTGAGTTTGTGTTTCAGTACGTATCAGCACCGTCGGTGGAGAGATGGGCTCTGCAGACACCGCCCGCGACCC
TCGTGGCTTCTCGATAAA
GTGAGCATCCCCCGACTACCAATGAGATCATCTTGCTGAGATACTTAGATTCCGCACACGGAAGGGCATCTGGGACCTGGTCATGAACAGTATGTATTTTCA
TCGATGGTGAAGCTATGTACTGACGTCTCCCGCAGACACACCTGTGTTCTTCATCCGCGATCCCGCCAAGTTCCCCCACTTCATTCACGTACGCTTTATCCACAAATCCGGTTAGCGAAG
GCACTCATGTCTCGATAGACCCAGAAGCGCGACCCGCAGACACACCTCCGCGATCACGAGTGCGTACTCTTTCTTCCAAGCTAAAGCACGATTCTGATGGCTTTACACAGCATGTTCTGG
GATTACCTGAGCTCAAACCCAGAGTCGCTCTACCAGGTGATGCGCCTCTTCTCGGACCTGGGCACGCCCAAGGGTGTGCGCCACCTGAACGCATGGACGGGGCATTCTTACCG
GTACGGC
ATCACAACCCCCTTCCCCAGATCTTGACTGACCTCGGCACAGATGGGTCAAGTCCGACGGCAGCTGGGTCTATGTGAAGCTGTATTGCGAGACGATGCAGGGCGTACGTGCCCCTCGCCG
CGCCCGCGCCCGCGCACCGCTGCTGACGCCCGCCCGCAGGTCCAGAACTTTACAAACGCAGAGGCGACGGCGATCGCGGGCGCGAACCCGGACTACGCGCAGCAGGACCTCTTCGAGGCG
ATCGAGAACAAGACGTACCCCGGCTGGGTGATGTACGCGCAGGTGCTCACGCCGCAGCAGGCGGAGCGCTTCAAGTACAACGTGCTCGACCTCACCAA
GTGCGTGTCCCGCCCGCTGTGG
AATGTGCGGACCGTCGCTGAGCGCAGGGCAGGGACTGGGGCTTCGACGACGTCCCGCGCCACGAGATCGGCCGCTTCTACCTCACGCAGAACCCCGCAAAGTGAGGCGTCATCTGCGAAG
TCACCCGCCCGCGGAGAAGATGCTCATGTGCTTCCTGTAAACGTAGCTACTTCGCCGAGATCGAGCAGGCGGCGTTCTCTCCTGGACGTATCGTGCCCGGCTGGGAGCCCTCGACGGACC
CGGTATTGCAGGCGCGCCTGTTCTCGTATGGAG
GTGCGCCGCCTGAACGAGACGCATCGTCGGCTGGATGCTTACGTCTCTCACTTTGTAGATGCGCAGCGTTACCGCCTTGGCGTGAAC
TACATG
GTAAGCGGGCGCCTTTACTACTGCAGGGATCGTCGTTGACCTCGTCTTCGTAGCAACTGCCTGTCAACGCACCGACATCGCCTGTTGGTATGTAATCCACTGTGTGTCATATGT
TGCCGGACGCTGACGGTTCCCGACAGCGAACTTCCAGCGTGATGGACATATGGCGTTCAGCAACCAAGGGTCCCGTCCAAATTACCTGTCGACCCTGCAGAAGATCAACCTCCCCCCTCT
GCCCTATGTTCAGGACACTCACCAGCGATGGATG
GTGCGTGGGACCAGGCCCCGCCTTCCCGTTCGTGGCTAATACAACACCCAGGGCGGCGCCGTCAAGTCGCTGTCGGAAGTGACGGC
CATCGACTTTGACTGGCCGCAACGCTTCTGGAAGAGCCTGTCCGAGCAGGACCAGAAGAACCTCATCGG
GTGCGTCCGTGTCTGATACCCGCGAGCGGCACCCCGCTGAGACTTCCTGTG
CAGCAACGTCGTGGGACACCTGGGCACCGTGAAGAGCGTGTCTGTCCGGCAGCGGCAGGTCGCGCTCTTCGCGCTCGTTGACCCTGCGCTGGGCAAGGCGGTTGCGGACGGCGTGGGCGT
CACGGTGCCCAGCCCCCTGCCGAGCTTCCCTGCGGGCCCGACGTGGCTCAACACGACGAAGCCGTCGGACAGCAGCACCCTGAATTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCGTGCAGCACTTGCTCTTGCGCTCGCACTCGCGTGCGCCGCGGCGCGCGCGCAGGACGCGTACACGTTCGATATCAACGCGGGCGTCGACGTCCAGGCCGCGACCGACGCGGAG
CCTGCGCCGCAGCTCACGTTTGCGACCGAGGCCGGCGTGCCGTACACGCACCCGTACGACGCACAGAAGATTGGCAGCGACG
GACCTCTCCTCCTCCAGGACCAGCACCTCGTCGAGACC
CTCGCGCACTTCGTGCGTGAGCGTATTCCGGAGCG
TGTTGTGCACGCAAAGGCCGCCGGTGCACATGGGTACTTTGAAGTTACGAATGCAGAGTGCGTGCATGAGACCTTGCGCGGTCAT
GCTTCGGTCCTCATTCTTATTCAGAATGGCTTGAAAACCCCGATCACAG
TACGTATCAGCACCGTCGGTGGAGAGATGGGCTCTGCAGACACCGCCCGCGACCCTCGTGGCTTCTCGATA
AA
ATTCCGCACACGGAAGGGCATCTGGGACCTGGTCATGAACAACACACCTGTGTTCTTCATCCGCGATCCCGCCAAGTTCCCCCACTTCATTCACACCCAGAAGCGCGACCCGCAGACA
CACCTCCGCGATCACGA
CATGTTCTGGGATTACCTGAGCTCAAACCCAGAGTCGCTCTACCAGGTGATGCGCCTCTTCTCGGACCTGGGCACGCCCAAGGGTGTGCGCCACCTGAACGCA
TGGACGGGGCATTCTTACCG
ATGGGTCAAGTCCGACGGCAGCTGGGTCTATGTGAAGCTGTATTGCGAGACGATGCAGGGCGTCCAGAACTTTACAAACGCAGAGGCGACGGCGATCGCG
GGCGCGAACCCGGACTACGCGCAGCAGGACCTCTTCGAGGCGATCGAGAACAAGACGTACCCCGGCTGGGTGATGTACGCGCAGGTGCTCACGCCGCAGCAGGCGGAGCGCTTCAAGTAC
AACGTGCTCGACCTCACCAA
GGACTGGGGCTTCGACGACGTCCCGCGCCACGAGATCGGCCGCTTCTACCTCACGCAGAACCCCGCAAACTACTTCGCCGAGATCGAGCAGGCGGCGTTC
TCTCCTGGACGTATCGTGCCCGGCTGGGAGCCCTCGACGGACCCGGTATTGCAGGCGCGCCTGTTCTCGTATGGAG
ATGCGCAGCGTTACCGCCTTGGCGTGAACTACATGCAACTGCCT
GTCAACGCACCGACATCGCCTGTTG
CGAACTTCCAGCGTGATGGACATATGGCGTTCAGCAACCAAGGGTCCCGTCCAAATTACCTGTCGACCCTGCAGAAGATCAACCTCCCCCCTCTG
CCCTATGTTCAGGACACTCACCAGCGATGGATG
GGCGGCGCCGTCAAGTCGCTGTCGGAAGTGACGGCCATCGACTTTGACTGGCCGCAACGCTTCTGGAAGAGCCTGTCCGAGCAGGAC
CAGAAGAACCTCATCGG
CAACGTCGTGGGACACCTGGGCACCGTGAAGAGCGTGTCTGTCCGGCAGCGGCAGGTCGCGCTCTTCGCGCTCGTTGACCCTGCGCTGGGCAAGGCGGTTGCG
GACGGCGTGGGCGTCACGGTGCCCAGCCCCCTGCCGAGCTTCCCTGCGGGCCCGACGTGGCTCAACACGACGAAGCCGTCGGACAGCAGCACCCTGAATTACTGA

Retrieve as FASTA