Entry information : PcHalPrx01
Entry ID 6735
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Catherine Mathe (Scipio))
Peroxidase information: PcHalPrx01
Name PcHalPrx01
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcHalPrx01
start..stop
S start..stop
PcarHalPrx01 510 0 1..295 1..296
PplHalPrx02 370 2.87e-130 3..281 2..280
PplHalPrx01 369 1.45e-129 5..285 4..283
PplHalPrx03 367 1.21e-128 5..285 4..283
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6735' 'join(1805204..1805468,1805756..1805959,1806018..1806219,1806277..1806493)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1805204..1805468 263 N° 2 1805756..1805959 202 N° 3 1806018..1806219 200 N° 4 1806277..1806493 215
join(1805204..1805468,1805756..1805959,1806018..1806219,1806277..1806493)


exon

Literature and cross-references PcHalPrx01
DNA ref. JGI genome:   scaffold_4 (1805204..1806493)
mRNA ref. JGI transcript:   3274
Protein sequence: PcHalPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   295 (323)
PWM (Da):   %s   32400.37 (35290.9)  
PI (pH):   %s   8.29 (7.36) Peptide Signal:   %s   cut: 25 range:25-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSLLVLLPARLSAGLYSALKAGLLNFLVILWDNGLALINLLTW
DRPAAAVVPKGCPGANGVWPEYAPPAEGDSRCSCPALNAMANH
GILPRSGRGITFKELSTTIRETYNFAPSFCFFVPNYAANMLCRDYWTDTFDLSDLDAHNCIEHDASLTREDCVFQRDQGKPARHLVEELLASGTGPNGDLTPADLSRISGKRRMESKAKN
GQFSLSTFHKFFGSS
NSSTMLTILGGRVKDLRPFLLEERIPDGWQSRIRHRMGLTMAEFNKTALQVEFGIKEEVFAASTSAQRRKTM

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGTTCTCTTCTCGTCCTCCTTCCCGCGAGATTGTCCGCCGGGCTCTATTCCGCGCTAAAAGCAGGCTTGCTGAACTTTCTCGTCATCCTCTGGGACAACGGGCTCGCGCTCATC
AACCTCCTGACGTGGGACCGTCCTGCCGCCGCGGTGGTCCCTAAGGGCTGCCCAGGCGCGAACGGAGTCTGGCCTGAGTACGCCCCGCCGGCAGAGGGCGACAGCCGCTGCTCATGCCCG
GCGCTGAACGCCATGGCGAATCACG
CGGTGCGTGAGAATGGGCGCGATAGGCTTTCCATGCCTCTCGCATCGCTGTCATGCGTGGAGCTCTCGTAACTCCGTTTTCTGCGACGCGCGATG
CGCTGGTTTTCCGTACCATCATGTTTTCGGTATATACCATTGCGATGGTCTGGCGTCTGTGCTATCACCGGTTAGCAGGGTAGGGTACGGGTACAATGTCAGGGATGCAAAGCATACCCG
TTGATTCATTGTTATCGTCACATCTCGCGTCAAGAATCGTCAGCCTCCGTTCTCAAGGCTAACTCCATCGTTAGGGATCCTACCTCGCTCTGGCCGCGGGATCACGTTCAAGGAGCTGTC
AACGACGATCCGGGAAACGTACAACTTTGCCCCAAGTTTCTGTTTCTTCGTACCCAACTATGCCGCGAACATGCTCTGCCGCGACTACTGGACCGACACGTTCGACCTGAGCGACCTGGA
CGCGCACAACTGCATCGAACACGACGCATCCCTGACGC
GCGTACGTACGTTTTCTTGGAACGGTGGAGCATCACGAACCTTACGTTACGCGCGCGCAGGCGAGGATTGCGTCTTCCAACG
GGACCAAGGGAAGCCCGCGCGCCATCTGGTGGAAGAGCTGTTGGCTTCTGGCACAGGGCCCAACGGAGATCTCACCCCGGCGGATCTCTCGCGCATCTCCGGAAAGAGACGTATGGAGTC
GAAGGCAAAGAACGGTCAATTCAGCTTGTCGACGTTCCACAAGTTCTTTGGCAGTTCGAA
AAGTGAGCATTCAATGAGAGACTTTTGCCTGTGCACTCACCAAATCTCGCATAACCCAGC
TCGTCTACGATGCTCACTATCCTTGGTGGGAGGGTAAAAGACCTCCGCCCGTTCCTCCTCGAGGAGCGCATCCCAGACGGCTGGCAGTCGCGCATCCGACACCGCATGGGACTGACCATG
GCGGAGTTCAACAAAACAGCGCTGCAGGTGGAGTTTGGGATTAAGGAGGAGGTCTTCGCCGCATCTACGAGCGCACAGCGACGAAAGACGATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGTTCTCTTCTCGTCCTCCTTCCCGCGAGATTGTCCGCCGGGCTCTATTCCGCGCTAAAAGCAGGCTTGCTGAACTTTCTCGTCATCCTCTGGGACAACGGGCTCGCGCTCATC
AACCTCCTGACGTGGGACCGTCCTGCCGCCGCGGTGGTCCCTAAGGGCTGCCCAGGCGCGAACGGAGTCTGGCCTGAGTACGCCCCGCCGGCAGAGGGCGACAGCCGCTGCTCATGCCCG
GCGCTGAACGCCATGGCGAATCACG
GGATCCTACCTCGCTCTGGCCGCGGGATCACGTTCAAGGAGCTGTCAACGACGATCCGGGAAACGTACAACTTTGCCCCAAGTTTCTGTTTCTTC
GTACCCAACTATGCCGCGAACATGCTCTGCCGCGACTACTGGACCGACACGTTCGACCTGAGCGACCTGGACGCGCACAACTGCATCGAACACGACGCATCCCTGACGC
GCGAGGATTGC
GTCTTCCAACGGGACCAAGGGAAGCCCGCGCGCCATCTGGTGGAAGAGCTGTTGGCTTCTGGCACAGGGCCCAACGGAGATCTCACCCCGGCGGATCTCTCGCGCATCTCCGGAAAGAGA
CGTATGGAGTCGAAGGCAAAGAACGGTCAATTCAGCTTGTCGACGTTCCACAAGTTCTTTGGCAGTTCGAA
CTCGTCTACGATGCTCACTATCCTTGGTGGGAGGGTAAAAGACCTCCGC
CCGTTCCTCCTCGAGGAGCGCATCCCAGACGGCTGGCAGTCGCGCATCCGACACCGCATGGGACTGACCATGGCGGAGTTCAACAAAACAGCGCTGCAGGTGGAGTTTGGGATTAAGGAG
GAGGTCTTCGCCGCATCTACGAGCGCACAGCGACGAAAGACGATGTAA

Retrieve as FASTA