1. Browse the Database
  2. View Redoxidase
Entry information : PcPrxQ
Entry ID 6746
Creation 2009-05-01 (Christophe Dunand)
Last sequence changes 2009-05-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Catherine Mathe (Scipio))
Peroxidase information: PcPrxQ
Name PcPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcPrxQ
start..stop		 S start..stop
PcarPrxQ01 396 1.79e-142 1..231 1..223
PplPrxQ01 250 2.92e-85 5..166 3..164
PinvPrxQ02 225 5.35e-75 5..237 4..205
SlutPrxQ01 214 7.08e-71 5..160 4..163
Gene structure Fichier Exons►


exon

Literature and cross-references PcPrxQ
DNA ref. JGI genome:   scaffold_12 (129804..130757)
mRNA ref. JGI transcript:   6867
EST ref. GenBank:   DV753320.1 [Fragment]
Protein sequence: PcPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   237
PWM (Da):   %s   25070.77  
PI (pH):   %s   5.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRSYPLTGKPAPPLSLPDANGQTYTLEPEKVGRPIVLFFYPKSGTYGCTKEACEFRDALVERESFKATNAQVIGISSDPVEKQKEFVDKHKLYPVLSDSAGEARKAYHIGKGLLGLVDA
RVTVVIDSKGIVRDSLEATMNYGAHVKFVTKWLEKLDAEEKQASAPPPTEPGLITEPALATEPGPETAPPIAGEAHALKMPAGPENGAGSSDVGSSAAMSDAQRDELGRAAQAVQA

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 2 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST