Entry information : PblPrxII02
Entry ID 6762
Creation 2009-05-06 (Christophe Dunand)
Last sequence changes 2009-05-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: PblPrxII02
Name PblPrxII02
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PblPrxII02
start..stop
S start..stop
PblPrxII01 191 1.44e-63 2..162 8..168
LbiPrxII 135 1.95e-41 2..162 9..169
AthiPrxII 130 3.41e-39 2..162 12..172
PpaPrxII0501 131 7.49e-39 2..162 89..243
Gene structure Fichier Exons


exon

Literature and cross-references PblPrxII02
DNA ref. JGI genome:   scaffold_19 (703536..702784)
mRNA ref. JGI transcript:   15844 [Incorrect splicing]
Protein sequence: PblPrxII02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17336.07  
PI (pH):   %s   5.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLPDLSLSYVPFDPKEDLQACPRPIPFKLHEELKGKKAVIFAIGAFTPTCSEQHVPEFLAKYDELKKHGIDKVICVSGNDGFVMNAFAKVSGSNGKVLMVSASDSGFFEALDLTIGEPKL
GSLLRPKRFALLVDDLVVKYVGVENGPGIEASGPASILSR

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. First exon=ATG.
DNA
Send to BLAST
CDS
Send to BLAST