Entry information : BdeGPx
Entry ID 6768
Creation 2009-05-09 (Christophe Dunand)
Last sequence changes 2011-12-14 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: BdeGPx
Name BdeGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Batrachochytrium
Organism Batrachochytrium dendrobatidis    [TaxId: 109871 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdeGPx
start..stop
S start..stop
BphGPx 216 2.15e-73 4..161 5..162
HchGPx 216 3.16e-73 6..162 3..159
BphyGPx 208 2.43e-70 4..161 2..159
RfeGPx 206 1.82e-69 4..163 2..161
Gene structure Fichier Exons


exon

Literature and cross-references BdeGPx
DNA ref. JGI genome:   scaffold_4 (1248638..1248052)
mRNA ref. JGI transcript:   10803
Protein sequence: BdeGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   18401.38  
PI (pH):   %s   7.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTDSPIYSFAVKDLRGTPVDLGQYKNKALLIVNTASKCGLTPQFAGLEALNKKYSDQGLQVIGFPCNQFMGQEPNEGEAIAEVCQRNYGVTFPMMEKINVNGADAHPLYQYIKKEAPGTL
GIEMIKWNFEKFLVDRNGKVVKRFAPTTTPESIEPEIAKLLASNHL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 introns).
DNA
Send to BLAST
CDS
Send to BLAST