Entry information : BdeFRe01
Entry ID 6773
Creation 2009-05-10 (Christophe Dunand)
Last sequence changes 2009-05-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: BdeFRe01
Name BdeFRe01
Class Ferric Reductase    [Orthogroup: FRe001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Batrachochytrium
Organism Batrachochytrium dendrobatidis    [TaxId: 109871 ]
Cellular localisation N/D
Tissue type N/D
Inducer Abscissic acid treatment
Repressor N/D
Best BLASTp hits
Perox score E-value BdeFRe01
start..stop
S start..stop
LeFRO05 125 2.79e-30 219..532 184..504
AgluFRO04 119 6.24e-28 220..525 222..543
LeFRO04 115 1.05e-26 220..542 216..560
AgluFRO01 114 1.65e-26 224..470 211..455
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6773' 'join(369516..370077,370203..371851)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 369516..370077 560 N° 2 370203..371851 1647  
join(369516..370077,370203..371851)


exon

Literature and cross-references BdeFRe01
DNA ref. JGI genome:   scaffold_3 (369516..371851)
mRNA ref. JGI transcript:   87228
Protein sequence: BdeFRe01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   737
PWM (Da):   %s   82501.31 Transmb domain:   %s   i21-43o63-82i143-165o180-202i229-251o271-289i296-318o451-473i571-593o624-646i
PI (pH):   %s   9.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVIAASPRKPILSPTVVRLAARILATLAMLVALVASYALASMVEGGKLRWSSSIMVVDRFDQWILGFALLPMFIATLSTFFSDPNTPDSIVTGRNDEYTISADGRSSTAHSTPLHCSGF
WNPRFKFLGKYSTLFKPWSQGDIMITCLLVISNILWWIAPVITRLYLKPSKTLSTPRGMLARFAIWA
AMAGLWNAAMAIVFVVRENHITKNIVGKDAGQFHRGLRYHIALGYTSFVQITF
HGTYYLTIMVIDGAFPNEILPTLSDTGYSNFFGFLAWLSLMLMALTSIFKVRRANYRIFYWTHQLYTCFLLFAFMHQTRTWYPVMASLVYFIFDRLLPRLKTQRTTSALLTRVSPSVVRL
DIAILQTYADSCTYSPGSWVNILVPSISHFNWHPFSISSSHHLTPRTVTLYIKARGAWTTQLHASSTGLGVMVPIKMDGFFGSRNNSYLSYQHLVVVGAGTGIATIIPYIYSYAQHTLGK
ITVFWLARTAVEACAYRSLLEALSDPNSPLAGRVDLHLHLTREQDSRVSTKHDHRIGSGFNGNPNFASTLSKSVGYEQSSTTTKPSYRLSAIFLSIIVFSAAAVGYVIGRTYVPAYNADE
CNADEAYTLVGLSHFMCWYYPQWAPTGFACLFAAISGLAFVWMVSLMKQTDAAVSNVEPIDVTPASFEWFKERFTWVAHRPNFAYELESVFNFYNSIENQSNIKIAVIAGGPERMVRDIE
NVVIDHGQAFFRESWK

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGTTATTGCTGCCAGTCCTCGCAAACCTATTTTATCACCAACTGTTGTTCGTCTAGCCGCCAGAATACTGGCTACGTTGGCCATGCTCGTGGCATTGGTGGCTTCTTACGCTTTA
GCATCAATGGTTGAAGGCGGAAAATTGCGCTGGAGTAGTTCCATTATGGTTGTGGATCGATTTGACCAATGGATTCTTGGATTCGCACTGTTACCCATGTTCATTGCCACACTATCTACC
TTTTTTAGCGATCCAAATACACCAGATTCTATAGTCACGGGAAGAAACGACGAGTACACAATATCTGCTGATGGTCGGTCTTCCACCGCCCACTCCACTCCACTTCATTGCTCTGGTTTC
TGGAATCCCCGTTTCAAATTCCTTGGTAAATACAGCACTCTTTTCAAACCATGGTCTCAAGGAGATATTATGATTACCTGTTTGCTTGTCATCTCCAATATTCTATGGTGGATTGCTCCT
GTGATTACTCGTCTGTATCTAAAACCCTCAAAAACACTTTCCACTCCCCGCGGCATGCTTGCTCGATTTGCAATTTGGGCCG
CGGTAAGTTTAAACATTTCACAAGCATATTCACCGTGT
AGCTGGATTTCAAGCTAGTGCATGTCCCTTTTCAACAGTACTAATTAAAAACTTGAACTGCTGCATACCTCTGTGATAAACATACATAGCCATGGCTGGTTTGTGGAATGCTGCAATGGC
TATTGTATTTGTTGTTCGTGAGAATCATATTACCAAAAACATTGTTGGCAAGGATGCTGGCCAGTTTCATCGTGGTCTCCGATATCACATTGCCTTGGGATACACGAGCTTTGTCCAAAT
TACCTTTCATGGCACATATTACCTTACTATCATGGTGATAGATGGTGCTTTTCCCAATGAGATACTGCCAACTCTCAGTGACACTGGCTATTCCAACTTTTTTGGATTTCTAGCTTGGCT
TTCTTTGATGCTTATGGCTCTGACCTCTATCTTTAAAGTGCGTCGTGCCAACTACCGCATCTTTTATTGGACGCATCAGCTTTATACCTGTTTCCTGCTTTTTGCGTTCATGCACCAAAC
TAGAACTTGGTATCCAGTTATGGCTTCACTCGTGTACTTTATCTTTGATCGGCTTTTACCTCGCCTTAAAACTCAGCGCACCACATCTGCTCTGCTCACTCGTGTTTCTCCGTCAGTAGT
TCGGCTGGATATTGCCATCTTGCAAACCTATGCAGATTCTTGTACATATTCTCCTGGCAGTTGGGTCAATATACTTGTTCCCTCAATTTCCCATTTCAATTGGCACCCATTTTCTATCTC
CTCCAGTCATCATCTTACTCCTCGCACCGTTACTCTATATATCAAGGCTCGAGGTGCATGGACTACGCAGCTGCACGCTTCGTCAACCGGCTTAGGTGTCATGGTTCCAATTAAGATGGA
CGGATTTTTTGGGTCGCGCAACAACAGCTACTTGTCCTACCAACACCTTGTTGTTGTGGGTGCTGGAACTGGTATTGCTACTATAATCCCCTACATATACAGCTATGCCCAACATACTCT
GGGGAAAATCACGGTATTTTGGTTGGCTCGCACTGCTGTTGAAGCGTGCGCATATCGTTCTCTACTTGAAGCTCTCTCTGATCCCAATTCACCACTTGCTGGTCGTGTCGACTTGCATCT
GCATTTGACTCGCGAGCAGGATTCTCGTGTATCTACTAAACACGACCATCGCATTGGATCCGGATTTAATGGAAACCCGAACTTTGCTTCCACCCTTTCTAAATCTGTTGGCTATGAACA
ATCAAGCACAACTACCAAACCATCCTACCGTTTGTCCGCCATTTTTCTTTCCATAATTGTATTTAGTGCTGCAGCTGTGGGATACGTTATTGGACGTACCTATGTTCCCGCATACAATGC
CGATGAATGCAATGCCGACGAAGCATACACGCTTGTTGGACTTTCTCACTTTATGTGTTGGTATTATCCCCAATGGGCACCTACTGGATTTGCCTGTCTATTTGCTGCTATCAGTGGTCT
TGCCTTTGTATGGATGGTCTCACTAATGAAGCAAACTGATGCTGCTGTTTCAAACGTGGAGCCTATTGATGTCACTCCCGCATCTTTCGAGTGGTTCAAGGAACGCTTTACCTGGGTCGC
TCATCGGCCAAACTTTGCCTATGAGCTTGAATCAGTGTTCAACTTTTATAATAGTATCGAGAATCAGTCTAACATTAAGATTGCTGTGATTGCCGGAGGTCCTGAGCGTATGGTTCGTGA
TATTGAAAATGTGGTGATTGATCACGGTCAAGCCTTTTTCCGCGAGTCTTGGAAAATG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGTTATTGCTGCCAGTCCTCGCAAACCTATTTTATCACCAACTGTTGTTCGTCTAGCCGCCAGAATACTGGCTACGTTGGCCATGCTCGTGGCATTGGTGGCTTCTTACGCTTTA
GCATCAATGGTTGAAGGCGGAAAATTGCGCTGGAGTAGTTCCATTATGGTTGTGGATCGATTTGACCAATGGATTCTTGGATTCGCACTGTTACCCATGTTCATTGCCACACTATCTACC
TTTTTTAGCGATCCAAATACACCAGATTCTATAGTCACGGGAAGAAACGACGAGTACACAATATCTGCTGATGGTCGGTCTTCCACCGCCCACTCCACTCCACTTCATTGCTCTGGTTTC
TGGAATCCCCGTTTCAAATTCCTTGGTAAATACAGCACTCTTTTCAAACCATGGTCTCAAGGAGATATTATGATTACCTGTTTGCTTGTCATCTCCAATATTCTATGGTGGATTGCTCCT
GTGATTACTCGTCTGTATCTAAAACCCTCAAAAACACTTTCCACTCCCCGCGGCATGCTTGCTCGATTTGCAATTTGGGCCG
CCATGGCTGGTTTGTGGAATGCTGCAATGGCTATTGTA
TTTGTTGTTCGTGAGAATCATATTACCAAAAACATTGTTGGCAAGGATGCTGGCCAGTTTCATCGTGGTCTCCGATATCACATTGCCTTGGGATACACGAGCTTTGTCCAAATTACCTTT
CATGGCACATATTACCTTACTATCATGGTGATAGATGGTGCTTTTCCCAATGAGATACTGCCAACTCTCAGTGACACTGGCTATTCCAACTTTTTTGGATTTCTAGCTTGGCTTTCTTTG
ATGCTTATGGCTCTGACCTCTATCTTTAAAGTGCGTCGTGCCAACTACCGCATCTTTTATTGGACGCATCAGCTTTATACCTGTTTCCTGCTTTTTGCGTTCATGCACCAAACTAGAACT
TGGTATCCAGTTATGGCTTCACTCGTGTACTTTATCTTTGATCGGCTTTTACCTCGCCTTAAAACTCAGCGCACCACATCTGCTCTGCTCACTCGTGTTTCTCCGTCAGTAGTTCGGCTG
GATATTGCCATCTTGCAAACCTATGCAGATTCTTGTACATATTCTCCTGGCAGTTGGGTCAATATACTTGTTCCCTCAATTTCCCATTTCAATTGGCACCCATTTTCTATCTCCTCCAGT
CATCATCTTACTCCTCGCACCGTTACTCTATATATCAAGGCTCGAGGTGCATGGACTACGCAGCTGCACGCTTCGTCAACCGGCTTAGGTGTCATGGTTCCAATTAAGATGGACGGATTT
TTTGGGTCGCGCAACAACAGCTACTTGTCCTACCAACACCTTGTTGTTGTGGGTGCTGGAACTGGTATTGCTACTATAATCCCCTACATATACAGCTATGCCCAACATACTCTGGGGAAA
ATCACGGTATTTTGGTTGGCTCGCACTGCTGTTGAAGCGTGCGCATATCGTTCTCTACTTGAAGCTCTCTCTGATCCCAATTCACCACTTGCTGGTCGTGTCGACTTGCATCTGCATTTG
ACTCGCGAGCAGGATTCTCGTGTATCTACTAAACACGACCATCGCATTGGATCCGGATTTAATGGAAACCCGAACTTTGCTTCCACCCTTTCTAAATCTGTTGGCTATGAACAATCAAGC
ACAACTACCAAACCATCCTACCGTTTGTCCGCCATTTTTCTTTCCATAATTGTATTTAGTGCTGCAGCTGTGGGATACGTTATTGGACGTACCTATGTTCCCGCATACAATGCCGATGAA
TGCAATGCCGACGAAGCATACACGCTTGTTGGACTTTCTCACTTTATGTGTTGGTATTATCCCCAATGGGCACCTACTGGATTTGCCTGTCTATTTGCTGCTATCAGTGGTCTTGCCTTT
GTATGGATGGTCTCACTAATGAAGCAAACTGATGCTGCTGTTTCAAACGTGGAGCCTATTGATGTCACTCCCGCATCTTTCGAGTGGTTCAAGGAACGCTTTACCTGGGTCGCTCATCGG
CCAAACTTTGCCTATGAGCTTGAATCAGTGTTCAACTTTTATAATAGTATCGAGAATCAGTCTAACATTAAGATTGCTGTGATTGCCGGAGGTCCTGAGCGTATGGTTCGTGATATTGAA
AATGTGGTGATTGATCACGGTCAAGCCTTTTTCCGCGAGTCTTGGAAAATG

Retrieve as FASTA