Entry information : PanCIIAA
Entry ID 6788
Creation 2009-05-13 (Christophe Dunand)
Last sequence changes 2017-05-22 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-05-22 (Catherine Mathe)
Peroxidase information: PanCIIAA
Name PanCIIAA
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Lasiosphaeriaceae Podospora
Organism Podospora anserina    [TaxId: 5145 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PanCIIAA
start..stop
S start..stop
MEspCIIAA02_NRRL54901 415 1e-144 1..358 1..358
GgrCIIAA02 378 6e-130 44..360 55..377
CfioCIIAA01_PJ7 376 2e-129 45..359 44..361
CfioCIIAA01_MH18 375 4e-129 45..359 44..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2125368..2125975 608 N° 2 2126047..2126428 382 N° 3 2126484..2126588 105  
join(2125368..2125975,2126047..2126428,2126484..2126588)


exon

Literature and cross-references PanCIIAA
Literature Espagne et al., The genome sequence of the model ascomycete fungus Podospora anserina. Genome Biol 9 (5), R77 (2008).
Protein ref. UniProtKB:   B2AB29
DNA ref. GenBank:   CU633438.1 (2125368..2127588)
mRNA ref. GenBank:   XM_001912774.1
EST ref. GenBank:   CU879768.1 [3' end]
Protein sequence: PanCIIAA
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (341)
PWM (Da):   %s   39996.25 (37666.0)  
PI (pH):   %s   8.67 (8.29) Peptide Signal:   %s   cut: 24 range:24-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKASSIATALAGGITMLSAAVQADPGMMNSSVLEALHEADRRPQELIGDLQWLQPRQMSPVSHLVRSILVDGFDAQSNEHYQYVPPLRSAACARDTCCVWWYIAKEMSQLFRGTDGQCTDAARGAIRTGFHDAGAWSKTTGDFGGADGSIVHAPEEMLRRPNKGLQEIVQQYKFWYDRWSHFGVSMADLIQMGANVATVVCPLGPRIRSFVGRRDNFKPAPDGLLPSPFDPPDKVIAMFRAKTIQPLSLAALLGAHSTSRQRFFNPARAGAPQDSTPGVCDVLFYRQTLAARSPPDVFRLPSDVVLAEHPLLFPAFKAFAGPGGQALWAHEYARAYLRLSLLGVFNINNLTDCTRVLPPRTLKW*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 2 introns) and 2 ESTs. Sequence without C-Term (last 3 exons are missing, confirmed with ESTs) and longer N-Term.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCCTCTTCTATCGCTACGGCCTTGGCCGGTGGCATAACCATGCTCTCAGCGGCGGTGCAAGCCGATCCGGGGATGATGAACTCGTCTGTTCTGGAAGCCCTCCACGAGGCAGAC
CGGAGGCCACAAGAGCTCATCGGTGACCTTCAATGGCTTCAACCTCGCCAGATGAGCCCCGTTTCCCACTTGGTCAGATCAATTCTGGTCGATGGCTTCGATGCTCAATCGAATGAGCAT
TACCAATACGTACCTCCCTTGCGTTCGGCAGCTTGTGCTCGAGACACTTGCTGCGTCTGGTGGTACATTGCCAAAGAAATGTCACAACTCTTCCGTGGCACTGATGGGCAATGTACAGAT
GCCGCCCGAGGTGCCATCCGCACCGGATTTCACGATGCCGGCGCGTGGTCCAAGACTACGGGCGATTTCGGGGGTGCTGACGGGTCCATCGTCCATGCACCCGAGGAGATGCTTCGCCGA
CCAAACAAGGGGCTTCAAGAGATTGTTCAACAGTACAAGTTTTGGTACGATCGCTGGAGCCATTTCGGTGTTAGCATGGCCGATTTGATCCAGATGGGCGCCAATGTCGCTACTGTTGTT
TGCCCTCT
GTAAGTCAATTACATCTTTTGCCTCGTTCTCTACTCCGTCTCACCGGTTGCTGACTCTGCCATCTCAACAGTGGCCCCCGCATCCGCTCCTTTGTTGGCCGCCGAGACAACT
TCAAGCCTGCTCCAGACGGGCTTCTCCCCAGCCCTTTCGACCCTCCCGACAAGGTCATCGCCATGTTCCGTGCCAAGACTATCCAACCGCTCAGCCTTGCCGCCCTGCTCGGTGCTCACT
CCACCAGCCGCCAACGTTTCTTCAATCCTGCGCGTGCTGGCGCCCCCCAGGACAGCACCCCAGGTGTTTGCGATGTGCTGTTCTACCGCCAGACTCTGGCTGCCCGCTCCCCTCCTGATG
TCTTCCGCCTCCCCAGCGATGTTGTCTTGGCTGAGCACCCCCTCCTGTTCCCGGCTTTCAAGGCTTTTGCCGGACCTGGTGGCCAGGCTCTTTGGGCTCAT
GTAAGCCTTGTCCTCAGCC
TTGTTGTGAAGTCCCGCTAACAGGAGTGTGTAATAGGAATACGCCCGCGCGTACCTCCGGCTTAGTCTTCTCGGTGTTTTCAACATCAACAACCTGACCGACTGCACCCGGGTGCTACCG
CCGAGAACGCTCAAGTGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCCTCTTCTATCGCTACGGCCTTGGCCGGTGGCATAACCATGCTCTCAGCGGCGGTGCAAGCCGATCCGGGGATGATGAACTCGTCTGTTCTGGAAGCCCTCCACGAGGCAGAC
CGGAGGCCACAAGAGCTCATCGGTGACCTTCAATGGCTTCAACCTCGCCAGATGAGCCCCGTTTCCCACTTGGTCAGATCAATTCTGGTCGATGGCTTCGATGCTCAATCGAATGAGCAT
TACCAATACGTACCTCCCTTGCGTTCGGCAGCTTGTGCTCGAGACACTTGCTGCGTCTGGTGGTACATTGCCAAAGAAATGTCACAACTCTTCCGTGGCACTGATGGGCAATGTACAGAT
GCCGCCCGAGGTGCCATCCGCACCGGATTTCACGATGCCGGCGCGTGGTCCAAGACTACGGGCGATTTCGGGGGTGCTGACGGGTCCATCGTCCATGCACCCGAGGAGATGCTTCGCCGA
CCAAACAAGGGGCTTCAAGAGATTGTTCAACAGTACAAGTTTTGGTACGATCGCTGGAGCCATTTCGGTGTTAGCATGGCCGATTTGATCCAGATGGGCGCCAATGTCGCTACTGTTGTT
TGCCCTCT
TGGCCCCCGCATCCGCTCCTTTGTTGGCCGCCGAGACAACTTCAAGCCTGCTCCAGACGGGCTTCTCCCCAGCCCTTTCGACCCTCCCGACAAGGTCATCGCCATGTTCCGT
GCCAAGACTATCCAACCGCTCAGCCTTGCCGCCCTGCTCGGTGCTCACTCCACCAGCCGCCAACGTTTCTTCAATCCTGCGCGTGCTGGCGCCCCCCAGGACAGCACCCCAGGTGTTTGC
GATGTGCTGTTCTACCGCCAGACTCTGGCTGCCCGCTCCCCTCCTGATGTCTTCCGCCTCCCCAGCGATGTTGTCTTGGCTGAGCACCCCCTCCTGTTCCCGGCTTTCAAGGCTTTTGCC
GGACCTGGTGGCCAGGCTCTTTGGGCTCAT
GAATACGCCCGCGCGTACCTCCGGCTTAGTCTTCTCGGTGTTTTCAACATCAACAACCTGACCGACTGCACCCGGGTGCTACCGCCGAGA
ACGCTCAAGTGGTGA

Retrieve as FASTA