Entry information : PtritCIIAB01 (Peroxidase40)
Entry ID 6799
Creation 2009-05-15 (Christophe Dunand)
Last sequence changes 2009-05-15 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PtritCIIAB01 (Peroxidase40)
Name (synonym) PtritCIIAB01 (Peroxidase40)
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Pyrenophora
Organism Pyrenophora tritici-repentis    [TaxId: 45151 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtritCIIAB01
start..stop
S start..stop
PterCIIAB01 621 0 1..333 1..335
AbraCIIAB01 489 5e-176 1..333 1..327
AalteCIIAB02 473 1e-169 1..333 1..327
CberCIIAB01 428 7e-152 1..333 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 917876..918479 604 N° 2 918540..918937 398  
join(917876..918479,918540..918937)


exon

Literature and cross-references PtritCIIAB01 (Peroxidase40)
Literature The Broad Institute Genome Sequencing Platform
Protein ref. GenPept:   XP_001934020 UniProtKB:   B2W2N9
DNA ref. JGI genome:   supercontig_1.3 (917876..918937)
mRNA ref. GenBank:   XM_001933985.1
Protein sequence: PtritCIIAB01 (Peroxidase40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333
PWM (Da):   %s   34881.27  
PI (pH):   %s   6.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYIRNVLIAGFAAASTVEAYGNSTIREEQKIWDVAHLGAPKGKRFLDDIFNMVGGILGGSGGGGDDDEPQCPEVWSQISKTLTEQFLGDGQCTDAARAAIRASFHDCFNGACDGSLILANECSNTENRGMERLCSNLANVATQTRVGVADLIQFAAAHAVKTCPGGPTVPVKVGRQDSSTPGALGVLPGPNVPGDTLVRSFASKGFSPIDLAALVGAHTAAKQRHSNPSKPGTSLDSTVGTWDNRFYSETRRGSAPFTLPSDRNVANHPATAISWTTFAVSKGAWDAAFVPAMVKLGMMGVESDGLIDCTSALPGGSRKRDIKNSNIFDRLNW

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Strain="Pt-1C-BFP"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAATGTCCTCATCGCCGGCTTTGCGGCTGCCAGCACAGTCGAAGCCTACGGCAACTCTACAATCCGAGAAGAGCAAAAGATCTGGGACGTCGCCCACCTCGGCGCACCA
AAGGGAAAGCGTTTCCTCGATGACATCTTCAACATGGTCGGAGGCATCCTAGGCGGCTCCGGCGGTGGCGGTGATGATGATGAGCCGCAATGCCCTGAAGTCTGGTCGCAAATCTCAAAG
ACACTCACCGAACAATTCCTCGGAGACGGACAATGCACAGACGCCGCTCGTGCTGCTATCCGCGCCTCCTTCCATGATTGCTTCAACGGCGCATGCGACGGTTCCCTCATCCTCGCAAAC
GAGTGTTCGAACACCGAAAACCGGGGTATGGAGCGTCTATGCAGTAACCTCGCCAATGTGGCCACACAAACCAGAGTCGGTGTAGCAGACCTCATCCAATTCGCTGCTGCACACGCTGTC
AAGACATGTCCTGGTGGCCCTACCGTTCCCGTTAAAGTTGGTCGTCAAGACTCCAGCACACCGGGTGCTCTTGGTGTACTACCCGGCCCCAATGTTCCAGGAGACACTTTGGTCCGATCA
TTCG
GTAAGCAAAAATACCTGCTTTTTCAAGTATGTAAATAATCGTACTAACCCAACTGTTCAGCATCCAAAGGCTTCAGCCCCATCGACCTCGCTGCCCTCGTCGGCGCACATACCGCA
GCCAAACAACGCCACAGCAACCCCTCCAAGCCCGGTACTTCGCTCGACTCCACCGTTGGCACTTGGGACAATAGGTTCTATTCCGAGACCAGGCGCGGTAGTGCGCCGTTCACTCTCCCG
TCAGACAGGAACGTTGCAAACCACCCGGCCACCGCAATTTCCTGGACTACCTTTGCTGTCAGCAAGGGCGCGTGGGATGCAGCCTTCGTGCCTGCAATGGTTAAGCTGGGTATGATGGGT
GTAGAGAGCGATGGTCTCATCGACTGTACTTCTGCGCTACCCGGCGGTAGCAGGAAGAGGGACATTAAGAACAGCAACATCTTCGACAGGTTGAACTGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAATGTCCTCATCGCCGGCTTTGCGGCTGCCAGCACAGTCGAAGCCTACGGCAACTCTACAATCCGAGAAGAGCAAAAGATCTGGGACGTCGCCCACCTCGGCGCACCA
AAGGGAAAGCGTTTCCTCGATGACATCTTCAACATGGTCGGAGGCATCCTAGGCGGCTCCGGCGGTGGCGGTGATGATGATGAGCCGCAATGCCCTGAAGTCTGGTCGCAAATCTCAAAG
ACACTCACCGAACAATTCCTCGGAGACGGACAATGCACAGACGCCGCTCGTGCTGCTATCCGCGCCTCCTTCCATGATTGCTTCAACGGCGCATGCGACGGTTCCCTCATCCTCGCAAAC
GAGTGTTCGAACACCGAAAACCGGGGTATGGAGCGTCTATGCAGTAACCTCGCCAATGTGGCCACACAAACCAGAGTCGGTGTAGCAGACCTCATCCAATTCGCTGCTGCACACGCTGTC
AAGACATGTCCTGGTGGCCCTACCGTTCCCGTTAAAGTTGGTCGTCAAGACTCCAGCACACCGGGTGCTCTTGGTGTACTACCCGGCCCCAATGTTCCAGGAGACACTTTGGTCCGATCA
TTCG
CATCCAAAGGCTTCAGCCCCATCGACCTCGCTGCCCTCGTCGGCGCACATACCGCAGCCAAACAACGCCACAGCAACCCCTCCAAGCCCGGTACTTCGCTCGACTCCACCGTTGGC
ACTTGGGACAATAGGTTCTATTCCGAGACCAGGCGCGGTAGTGCGCCGTTCACTCTCCCGTCAGACAGGAACGTTGCAAACCACCCGGCCACCGCAATTTCCTGGACTACCTTTGCTGTC
AGCAAGGGCGCGTGGGATGCAGCCTTCGTGCCTGCAATGGTTAAGCTGGGTATGATGGGTGTAGAGAGCGATGGTCTCATCGACTGTACTTCTGCGCTACCCGGCGGTAGCAGGAAGAGG
GACATTAAGAACAGCAACATCTTCGACAGGTTGAACTGGTAG

Retrieve as FASTA