Entry information : PtritCIIAB04
Entry ID 6800
Creation 2009-05-15 (Christophe Dunand)
Last sequence changes 2009-05-15 (Christophe Dunand)
Sequence status complete
Reviewer Michele Oliva
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PtritCIIAB04
Name PtritCIIAB04
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Pyrenophora
Organism Pyrenophora tritici-repentis    [TaxId: 45151 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtritCIIAB04
start..stop
S start..stop
AalteCIIAB01 398 3e-141 1..293 1..294
Ssrc1lsm3aCIIAB06 378 4e-133 7..276 7..276
ClunCIIAB02 375 3e-132 7..293 8..295
AbraCIIAB03 375 3e-132 1..292 1..293
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 267121..267792 672 N° 2 267847..268056 210  
join(267121..267792,267847..268056)


exon

Literature and cross-references PtritCIIAB04
Protein ref. GenPept:   XP_001930435
DNA ref. JGI genome:   supercontig_1.1 (267121..268056)
mRNA ref. GenBank:   XM_001930400.1
Protein sequence: PtritCIIAB04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   293 (275)
PWM (Da):   %s   31105.3 (29225.3)  
PI (pH):   %s   6.88 (6.50) Peptide Signal:   %s   cut: 19 range:19-293
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRFSPASFLALATAPTFALNIWPRASSCPAVWTKVAAELQADFAGCTADAHQSIRSSFHDCINNGCDGSLVLTDECGRAENMGLSKICTKIQGWATKYDVGVADMLQFAAAQGISACPLGPKVPILIGRKDSSVAAPLHSVPGSRDPLDSILAAFSAKGFDGKDVVALMGTHSVAFQFFDDPSQAGKTLDSTPNVYDTTFYKETKDGTAPYTLQSDKLLSNSSQTENAWNSFIDNGNAWATAFVDAWARFAVIGNDPSQMVDCSSLVPASRASKKRQAAVAAFTKKMSAKWRL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 introns). Strain="Pt-1C-BFP".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTTCTCACCAGCATCTTTCCTTGCTCTCGCAACAGCACCAACCTTTGCCCTCAATATCTGGCCCCGCGCCTCCAGTTGCCCTGCAGTCTGGACCAAAGTTGCCGCAGAACTCCAA
GCAGACTTTGCCGGATGCACCGCAGATGCCCACCAAAGCATCCGCTCCAGCTTTCATGACTGCATCAATAATGGCTGCGATGGCAGCCTGGTTCTGACCGACGAATGCGGTCGTGCAGAA
AATATGGGCCTTTCGAAAATCTGCACCAAGATCCAGGGTTGGGCCACCAAATATGATGTTGGTGTTGCCGACATGCTTCAGTTCGCCGCTGCTCAAGGCATTTCCGCCTGCCCTCTCGGA
CCAAAAGTACCAATCCTCATTGGGCGTAAAGACAGCAGCGTTGCGGCACCTCTGCACAGCGTACCAGGAAGCCGAGACCCTCTGGACTCTATCCTAGCCGCATTCAGTGCAAAGGGATTT
GACGGCAAGGATGTCGTTGCATTAATGGGCACGCACAGTGTCGCCTTCCAGTTCTTCGACGACCCATCACAGGCGGGAAAGACTCTGGACAGTACGCCTAACGTTTATGACACCACATTC
TACAAGGAGACCAAGGATGGAACAGCGCCGTACACGCTGCAAAGTGACAAGCTTCTCTCAAATTCGAGCCAG
GTATGTTTCCCCCTGTCCCTTTCTTCCCCAGATTCCCACTCACATCAT
CCACAGACTGAGAATGCTTGGAATTCCTTCATCGACAATGGAAATGCGTGGGCAACTGCTTTCGTTGACGCATGGGCTCGCTTTGCTGTTATTGGAAACGACCCCAGCCAAATGGTAGAT
TGCTCTAGCTTGGTTCCTGCATCAAGGGCCAGCAAGAAGAGGCAGGCTGCTGTTGCCGCATTCACCAAGAAGATGAGTGCCAAGTGGCGGTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTTCTCACCAGCATCTTTCCTTGCTCTCGCAACAGCACCAACCTTTGCCCTCAATATCTGGCCCCGCGCCTCCAGTTGCCCTGCAGTCTGGACCAAAGTTGCCGCAGAACTCCAA
GCAGACTTTGCCGGATGCACCGCAGATGCCCACCAAAGCATCCGCTCCAGCTTTCATGACTGCATCAATAATGGCTGCGATGGCAGCCTGGTTCTGACCGACGAATGCGGTCGTGCAGAA
AATATGGGCCTTTCGAAAATCTGCACCAAGATCCAGGGTTGGGCCACCAAATATGATGTTGGTGTTGCCGACATGCTTCAGTTCGCCGCTGCTCAAGGCATTTCCGCCTGCCCTCTCGGA
CCAAAAGTACCAATCCTCATTGGGCGTAAAGACAGCAGCGTTGCGGCACCTCTGCACAGCGTACCAGGAAGCCGAGACCCTCTGGACTCTATCCTAGCCGCATTCAGTGCAAAGGGATTT
GACGGCAAGGATGTCGTTGCATTAATGGGCACGCACAGTGTCGCCTTCCAGTTCTTCGACGACCCATCACAGGCGGGAAAGACTCTGGACAGTACGCCTAACGTTTATGACACCACATTC
TACAAGGAGACCAAGGATGGAACAGCGCCGTACACGCTGCAAAGTGACAAGCTTCTCTCAAATTCGAGCCAG
ACTGAGAATGCTTGGAATTCCTTCATCGACAATGGAAATGCGTGGGCA
ACTGCTTTCGTTGACGCATGGGCTCGCTTTGCTGTTATTGGAAACGACCCCAGCCAAATGGTAGATTGCTCTAGCTTGGTTCCTGCATCAAGGGCCAGCAAGAAGAGGCAGGCTGCTGTT
GCCGCATTCACCAAGAAGATGAGTGCCAAGTGGCGGTTGTAA

Retrieve as FASTA