Entry information : MgCIIAC01
Entry ID 6814
Creation 2009-05-19 (Christophe Dunand)
Last sequence changes 2009-05-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: MgCIIAC01
Name MgCIIAC01
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Mycosphaerella graminicola (Septoria tritici)    [TaxId: 54734 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MgCIIAC01
start..stop
S start..stop
BdotCIIAC02 347 1e-119 1..331 1..338
ApulCIIAC02 337 1e-115 31..331 46..344
ApulCIIAC01 303 7e-103 35..331 16..305
ApruCIIAC01 297 1e-99 39..331 76..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 481986..482610 625 N° 2 481686..481921 236 N° 3 481477..481620 144  
complement(join(481477..481620,481686..481921,481986..482610))


exon

Literature and cross-references MgCIIAC01
DNA ref. JGI genome:   chr_13 (482610..481477)
mRNA ref. JGI transcript:   51544   26620 [Fragment]
Protein sequence: MgCIIAC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (315)
PWM (Da):   %s   34914.6 (32798.5)  
PI (pH):   %s   8.72 (8.62) Peptide Signal:   %s   cut: 20 range:20-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRFQFILITCLTSIAAVHALQAPTWPQLSSLVRRQGGSTCPSFWQTIGKDLQQSFLTTDKRECNDMARAAVRYAFHDAGTFSLKLPFAWPAAGGADGSLLLASSEIGRPANGGLGPYHGFIGGKLGSYRSQFGNGVGAADLIQFAASVATVVCPGGPIVKTVVGRVDSTQASPANLLPPGFGQGSDHDSLLNLFSDKGFYAKDLAALIGAHSVATAFAQSGNGVPVNASLDSTPGKWDNNFYGETYNPPPGISRLQSDINLSDPAKAVGQEFRGFVGNPAKWALAFDAMHRLSVLGIPQGISQGFADCTSALPGGTASTKRMRSAPLMERWVK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 13, 2 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGTTCCAATTCATTCTCATCACTTGTCTCACGAGCATTGCCGCTGTGCATGCCCTTCAAGCACCGACTTGGCCTCAATTATCCTCACTGGTCCGGCGACAAGGCGGCAGCACCTGT
CCTTCCTTCTGGCAGACTATCGGCAAAGATCTCCAGCAATCATTCTTGACCACGGACAAGCGAGAATGCAACGACATGGCGCGAGCAGCGGTCCGTTATGCATTCCATGATGCTGGAACA
TTCTCCCTCAAACTACCATTCGCTTGGCCTGCCGCGGGTGGCGCCGATGGTAGTCTTCTGCTGGCATCCTCGGAGATTGGAAGACCCGCGAACGGCGGCCTAGGGCCCTATCACGGCTTC
ATCGGTGGCAAGCTGGGCTCTTACCGAAGCCAGTTCGGCAACGGCGTGGGCGCGGCTGACTTGATACAATTCGCTGCCAGTGTGGCGACGGTTGTCTGTCCCGGAGGACCGATCGTGAAG
ACGGTGGTCGGCCGCGTTGATTCGACGCAGGCGTCGCCCGCGAACTTGTTGCCGCCAGGATTCGGTCAAGGATCGGACCACGATTCGCTGCTGAATTTGTTCTCCGATAAGGGGTTCTAT
GCCAAAGACCTGGCAGCTCTTATTG
GTGAGACGTACAACCTCATGTCGATACGCTGTATGGGAGCTCAGACTGACGTGATAACATATAGGGGCACATAGTGTTGCGACGGCCTTTGCGCA
ATCAGGGAATGGCGTCCCGGTGAACGCTTCTCTGGACTCAACACCCGGCAAATGGGACAACAATTTCTACGGCGAGACGTACAACCCACCACCTGGCATCTCTCGTCTCCAGTCGGACAT
TAATCTTTCGGACCCGGCCAAAGCAGTCGGTCAGGAATTCAGGGGATTCGTTGGGAATCCCGCCAAGTGGGCCTTGGCTTTCGCA
GTATGTAACGACGAGCAGCAGCGTTGATCATTGGG
AGCGATGGAGTTTGGCTGACACCTTGACAGGACGCTATGCATCGGTTGAGCGTGCTGGGAATTCCACAGGGAATATCGCAGGGCTTTGCGGACTGTACGTCTGCTTTACCCGGCGGGACC
GCTTCGACGAAGAGAATGAGGAGTGCCCCTCTGATGGAGCGCTGGGTCAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGTTCCAATTCATTCTCATCACTTGTCTCACGAGCATTGCCGCTGTGCATGCCCTTCAAGCACCGACTTGGCCTCAATTATCCTCACTGGTCCGGCGACAAGGCGGCAGCACCTGT
CCTTCCTTCTGGCAGACTATCGGCAAAGATCTCCAGCAATCATTCTTGACCACGGACAAGCGAGAATGCAACGACATGGCGCGAGCAGCGGTCCGTTATGCATTCCATGATGCTGGAACA
TTCTCCCTCAAACTACCATTCGCTTGGCCTGCCGCGGGTGGCGCCGATGGTAGTCTTCTGCTGGCATCCTCGGAGATTGGAAGACCCGCGAACGGCGGCCTAGGGCCCTATCACGGCTTC
ATCGGTGGCAAGCTGGGCTCTTACCGAAGCCAGTTCGGCAACGGCGTGGGCGCGGCTGACTTGATACAATTCGCTGCCAGTGTGGCGACGGTTGTCTGTCCCGGAGGACCGATCGTGAAG
ACGGTGGTCGGCCGCGTTGATTCGACGCAGGCGTCGCCCGCGAACTTGTTGCCGCCAGGATTCGGTCAAGGATCGGACCACGATTCGCTGCTGAATTTGTTCTCCGATAAGGGGTTCTAT
GCCAAAGACCTGGCAGCTCTTATTG
GGGCACATAGTGTTGCGACGGCCTTTGCGCAATCAGGGAATGGCGTCCCGGTGAACGCTTCTCTGGACTCAACACCCGGCAAATGGGACAACAAT
TTCTACGGCGAGACGTACAACCCACCACCTGGCATCTCTCGTCTCCAGTCGGACATTAATCTTTCGGACCCGGCCAAAGCAGTCGGTCAGGAATTCAGGGGATTCGTTGGGAATCCCGCC
AAGTGGGCCTTGGCTTTCGCA
GACGCTATGCATCGGTTGAGCGTGCTGGGAATTCCACAGGGAATATCGCAGGGCTTTGCGGACTGTACGTCTGCTTTACCCGGCGGGACCGCTTCGACG
AAGAGAATGAGGAGTGCCCCTCTGATGGAGCGCTGGGTCAAGTGA

Retrieve as FASTA