Entry information : MgCIIAA02
Entry ID 6815
Creation 2009-05-25 (Christophe Dunand)
Last sequence changes 2017-05-23 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-05-23 (Catherine Mathe)
Peroxidase information: MgCIIAA02
Name MgCIIAA02
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Mycosphaerella graminicola (Septoria tritici)    [TaxId: 54734 ]
Cellular localisation N/D
Tissue type N/D
Inducer Infected host
Repressor N/D
Best BLASTp hits
Perox score E-value MgCIIAA02
start..stop
S start..stop
ZbreCIIAA 626 0 21..357 55..387
ApulCIIAA01 385 7e-134 33..351 53..365
BdotCIIAA02 379 3e-131 29..354 45..362
TclaCIIAA01 376 3e-130 31..347 36..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3647769..3647808 40 N° 2 3648207..3648407 201 N° 3 3648467..3649183 717 N° 4 3649261..3649376 116
join(3647769..3647808,3648207..3648407,3648467..3649183,3649261..3649376)


exon

Literature and cross-references MgCIIAA02
Literature Kema,G.H.J., van der Lee,T.A.J., Mendes,O., Verstappen,E.C.P., Lankhorst,R.K., Sandbrink,H., van der Burgt,A., Zwiers,L.H., Csukai ,M. and Waalwijk,C. Large scale gene discovery in the Septoria tritici blotch fungus Mycosphaerella graminicola with a focus on in planta expression
DNA ref. JGI genome:   chr_1 (3647769..3649374)
mRNA ref. JGI transcript:   89649 [Incorrect splicing]
EST ref. GenBank:   FM219106.1 [Fragment]
Protein sequence: MgCIIAA02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357
PWM (Da):   %s   39212.7  
PI (pH):   %s   8.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFCGETSPPILLARGHHQEIRAVTPLYNTRLIGNLVNGATTPVGKSVSNILLGNEKAESEPNGYRAPGPLNSKRCRADTCCVWSHISNAMTSAFTGSRRQSLTxCNNVARAAIRLDFHDAGPWSSELAAQGQDFGGADGSIVLSGSEIGRKEDRGLERMPAQMKQWQRTFNVSMADLIQFGAIHAVVTCPLGSRIRFFAGRKDSRVPAVEGLLPSVTAPADELISLFRAKTIEPHELAALLGAHSTSIQRFVDPALAGRPQDSTPMIWDVKYYNETIQERPRRIFRLQTDVALAANPSMKDEWMDFIDPVDGQDHWNSDYATAYTRLSLLGVNNINQMTECSQVLPAETRRRPRFA*

Retrieve as FASTA  
Remarks Partial sequence from genomic (chromo 1, 2 introns) and 1 EST. Strain="IPO323". Incorrect prediction from JGI, frame shift, stop codons.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTTCTGCGGAGAGACAAGTCCGCCGATCCTGCTTGGTACGACGGTTCGTACCACTCAACGGAGACGTCAGGTCGTGCATTCGTCCACGGCGTACTGGGACCCAGCTTGATTGCTG
TCTTCACACCGACCACTCGCCGGAGTTTGCGCCGGTGGTGTGGTCGCACGAGCGCGAGACCATGGCAAACGCAGTCCATCGATCGACGAGCCATCAGCTGTGCCTGCGCCCTTTACAGGA
TCCGGATCCTTGGCCTACACAATTGGCAAGATCGCTAGAGGCCCTATCGAGCGTTCTCTACATGCATCTACCGCTTTAGAAAACCCAAGGCTAAACGCTCCTCCAAAGTCTTGTGAGGTC
TTTTCCGAGTCTCGTGAGGGCCCCTTGGGAGATCTCAGCAAGCCGAAACGATCCCACGATATTGAACGCCTGCGATAGCGCGAGGTCATCATCAAGAAATACGAGCCGTCACTCCGCTGT
ACAACACCCGCTTGATCGGCAACTTGGTCAATGGGGCGACGACACCCGTCGGCAAGAGCGTCTCGAACATTCTCTTGGGGAACGAAAAGGCCGAGTCCGAACCCAATGGCTATCGTGCGC
CGGGTCCATTAAACTCGAAGAGATGCCGAGCTGATACAT
GTAAGGTATTCCCACGAGCCGGAAGGTACGAAGGCCAATTCTAACCACGCAGATCGCAGGCTGCGTTTGGTCTCACATATC
TAACGCAATGACCTCTGCGTTTACAGGCAGCAGGAGACAGTCACTTACAGNNTGTAACAACGTCGCCCGCGCCGCGATACGTCTCGATTTCCACGATGCCGGACCGTGGTCGAGCGAGCT
GGCGGCTCAAGGACAAGACTTCGGCGGTGCAGACGGCAGCATCGTGCTTTCCGGCTCCGAGATTGGACGAAAGGAGGATCGCGGCCTGGAGCGGATGCCAGCGCAGATGAAACAGTGGCA
GAGGACTTTCAACGTATCGATGGCGGATCTGATCCAGTTCGGCGCCATCCATGCCGTCGTGACTTGTCCTCTGGGATCGCGTATCCGATTCTTCGCGGGGCGCAAAGACTCCCGAGTACC
AGCGGTCGAAGGACTTCTGCCTTCGGTGACTGCACCTGCCGATGAGCTCATCAGCCTGTTCCGTGCCAAGACGATCGAGCCTCATGAGTTGGCAGCACTTCTGGGTGCTCACTCGACAAG
TATCCAGAGGTTTGTGGATCCCGCGCTGGCAGGTCGTCCGCAGGATAGCACGCCGATGATCTGGGACGTCAAATACTACAACGAGACGATCCAGGAAAGGCCGAGAAGGATTTTTAGATT
GCAGACCGATGTTGCTCTCGCTGCAAATCCTTCGATGAAGGATGAGTGGATGGATTTTATCGATCCCGTCGACGGGCAGGACCACTGGAACTCGG
GTGAGTCGGCCTGATACGCCAAACC
ACAGATCTTGCTCCTTCTCCCGTCTACGAGCCTTGCTAACGGTCTACTGCAGACTACGCAACCGCTTACACTCGCTTGAGCTTGCTTGGAGTCAACAATATCAATCAGATGACGGAGTGT
TCTCAAGTACTGCCTGCTGAAACCAGAAGGAGGCCTCGGTTCGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTTCTGCGGAGAGACAAGTCCGCCGATCCTGCTTGCGCGAGGTCATCATCAAGAAATACGAGCCGTCACTCCGCTGTACAACACCCGCTTGATCGGCAACTTGGTCAATGGGGCG
ACGACACCCGTCGGCAAGAGCGTCTCGAACATTCTCTTGGGGAACGAAAAGGCCGAGTCCGAACCCAATGGCTATCGTGCGCCGGGTCCATTAAACTCGAAGAGATGCCGAGCTGATACA
T
GCTGCGTTTGGTCTCACATATCTAACGCAATGACCTCTGCGTTTACAGGCAGCAGGAGACAGTCACTTACAGNNTGTAACAACGTCGCCCGCGCCGCGATACGTCTCGATTTCCACGAT
GCCGGACCGTGGTCGAGCGAGCTGGCGGCTCAAGGACAAGACTTCGGCGGTGCAGACGGCAGCATCGTGCTTTCCGGCTCCGAGATTGGACGAAAGGAGGATCGCGGCCTGGAGCGGATG
CCAGCGCAGATGAAACAGTGGCAGAGGACTTTCAACGTATCGATGGCGGATCTGATCCAGTTCGGCGCCATCCATGCCGTCGTGACTTGTCCTCTGGGATCGCGTATCCGATTCTTCGCG
GGGCGCAAAGACTCCCGAGTACCAGCGGTCGAAGGACTTCTGCCTTCGGTGACTGCACCTGCCGATGAGCTCATCAGCCTGTTCCGTGCCAAGACGATCGAGCCTCATGAGTTGGCAGCA
CTTCTGGGTGCTCACTCGACAAGTATCCAGAGGTTTGTGGATCCCGCGCTGGCAGGTCGTCCGCAGGATAGCACGCCGATGATCTGGGACGTCAAATACTACAACGAGACGATCCAGGAA
AGGCCGAGAAGGATTTTTAGATTGCAGACCGATGTTGCTCTCGCTGCAAATCCTTCGATGAAGGATGAGTGGATGGATTTTATCGATCCCGTCGACGGGCAGGACCACTGGAACTCGG
AC
TACGCAACCGCTTACACTCGCTTGAGCTTGCTTGGAGTCAACAATATCAATCAGATGACGGAGTGTTCTCAAGTACTGCCTGCTGAAACCAGAAGGAGGCCTCGGTTCGCCTGA

Retrieve as FASTA