Entry information : MfiCIIAC01
Entry ID 6825
Creation 2009-05-22 (Christophe Dunand)
Last sequence changes 2009-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: MfiCIIAC01
Name MfiCIIAC01
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Mycosphaerella fijiensis (Pseudocercospora fijiensis)    [TaxId: 83344 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MfiCIIAC01
start..stop
S start..stop
MfiCIIAC02 370 1e-129 20..307 34..317
CfulCIIAC01 366 1e-127 34..307 54..328
MpiCIIAC01 351 7e-122 29..307 25..318
ZcelCIIAC02 335 4e-115 39..308 87..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1714798..1715165 368 N° 2 1715225..1715318 94 N° 3 1715371..1715569 199 N° 4 1715624..1715782 159
N° 5 1715830..1715936 107  
join(1714798..1715165,1715225..1715318,1715371..1715569,1715624..1715782,1715830 ..1715936)


exon

Literature and cross-references MfiCIIAC01
DNA ref. JGI genome:   scaffold_2 (1714798..1715936)
mRNA ref. JGI transcript:   52909
EST ref. GenBank:   FD664895.1 [5' end]   FD674149.1 [3' end]
Protein sequence: MfiCIIAC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   308 (291)
PWM (Da):   %s   32131.91 (30296.9)  
PI (pH):   %s   7.34 (7.38) Peptide Signal:   %s   cut: 18 range:18-308
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLILFLWSVTALLCSGVSLERRAPQFGAGSGHGGGSGCPSVWTQIASDLRLDFAGCNDLARSAIRFAFHDAAGYSVKNPTYAPASGGADGSLLLNDEEISRPANNPLKQNYRDKYLLAKYNQYKSNGISAADLVQFAGSVGTRSCRGGPIVRVVGRNDSTTAAPDGLLPNAFGPGSDADTLLALWADKGISARELAALMGAHSTSRSFSEEANGIPAGGPQDSTPGVWDVTYYRQAQERRNPPGVYRFNSDVNLANASATGPSFTQFGRNQGLWANEFSAAMAKLSVAGIPASTVAGFVDCTSLIF

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 30 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCTAATCCTGTTCCTCTGGTCTGTCACAGCTCTGCTTTGCAGTGGCGTAAGCCTGGAGAGGAGAGCACCTCAATTCGGAGCGGGTAGCGGTCATGGCGGAGGCTCTGGATGTCCA
TCTGTCTGGACGCAGATAGCTTCTGATCTGAGGTTGGACTTTGCTGGATGCAACGACCTGGCCAGATCAGCGATTCGATTCGCGTTCCATGATGCGGCTGGCTACTCTGTAAAGAACCCA
ACCTATGCCCCAGCGTCTGGCGGCGCGGACGGCTCGCTACTGTTGAATGATGAGGAGATATCTCGGCCAGCGAACAACCCTTTGAAGCAGAATTACCGGGATAAATATCTCCTTGCGAAA
TACAACCA
GTAAGTCGTTTCCGGCAGTCGGTGGGTCAGAGTCACTGATATATCACTTTATCCCCCAGATACAAATCGAACGGCATCTCCGCTGCCGATCTCGTGCAATTCGCTGGTAGTG
TAGGCACCCGAAGTTGCAGAGGCGGCCCGATTGTGAGAACG
GTGAGCAGATCTGATCTTTGCTCCGCCGAAATCAGATGCTAATTAATCGCAGGTGGTCGGACGAAACGATAGCACAACA
GCAGCACCAGACGGCCTCCTTCCAAACGCTTTCGGTCCAGGATCGGACGCAGACACACTACTCGCACTTTGGGCCGACAAAGGTATCAGTGCCAGAGAGCTGGCAGCACTCATGGGAGCG
CATTCCACGTCCAGATCTTTCAGTGAAGAGGCGAATGGCATTCCAGCTGGAG
GTTAGTCAGGTATGCTGCAAATTAAAATTGTGCTCAAGCTCATCAGCGCAACAGGACCACAGGACTCC
ACTCCAGGAGTTTGGGATGTCACATATTACCGTCAAGCACAAGAACGGAGGAATCCTCCAGGGGTGTATCGTTTCAACTCGGATGTGAACCTCGCGAATGCTTCGGCCACTGGTCCCTCG
TTCACGCAATTCGGCCGCAATCAAG
GTTCGTTCGATATTGATCCAGAAAGGGCATGCGCTGACGTGGGGTAGGCTTGTGGGCGAATGAGTTTTCGGCTGCGATGGCTAAGCTGAGCGTGG
CTGGCATACCAGCAAGCACAGTGGCAGGATTTGTAGACTGCACGTCCTTGATATTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCTAATCCTGTTCCTCTGGTCTGTCACAGCTCTGCTTTGCAGTGGCGTAAGCCTGGAGAGGAGAGCACCTCAATTCGGAGCGGGTAGCGGTCATGGCGGAGGCTCTGGATGTCCA
TCTGTCTGGACGCAGATAGCTTCTGATCTGAGGTTGGACTTTGCTGGATGCAACGACCTGGCCAGATCAGCGATTCGATTCGCGTTCCATGATGCGGCTGGCTACTCTGTAAAGAACCCA
ACCTATGCCCCAGCGTCTGGCGGCGCGGACGGCTCGCTACTGTTGAATGATGAGGAGATATCTCGGCCAGCGAACAACCCTTTGAAGCAGAATTACCGGGATAAATATCTCCTTGCGAAA
TACAACCA
ATACAAATCGAACGGCATCTCCGCTGCCGATCTCGTGCAATTCGCTGGTAGTGTAGGCACCCGAAGTTGCAGAGGCGGCCCGATTGTGAGAACGGTGGTCGGACGAAACGAT
AGCACAACAGCAGCACCAGACGGCCTCCTTCCAAACGCTTTCGGTCCAGGATCGGACGCAGACACACTACTCGCACTTTGGGCCGACAAAGGTATCAGTGCCAGAGAGCTGGCAGCACTC
ATGGGAGCGCATTCCACGTCCAGATCTTTCAGTGAAGAGGCGAATGGCATTCCAGCTGGAG
GACCACAGGACTCCACTCCAGGAGTTTGGGATGTCACATATTACCGTCAAGCACAAGAA
CGGAGGAATCCTCCAGGGGTGTATCGTTTCAACTCGGATGTGAACCTCGCGAATGCTTCGGCCACTGGTCCCTCGTTCACGCAATTCGGCCGCAATCAAG
GCTTGTGGGCGAATGAGTTT
TCGGCTGCGATGGCTAAGCTGAGCGTGGCTGGCATACCAGCAAGCACAGTGGCAGGATTTGTAGACTGCACGTCCTTGATATTTTGA

Retrieve as FASTA