Entry information : PcLiP04_RP78 (PcLiPD_RP78)
Entry ID 6832
Creation 2009-05-28 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-29 (Nizar Fawal)
Peroxidase information: PcLiP04_RP78 (PcLiPD_RP78)
Name (synonym) PcLiP04_RP78 (PcLiPD_RP78)
Class Lignin peroxidase    [Orthogroup: LiP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcLiP04_RP78
start..stop
S start..stop
PcLiP04_BKMF1767 753 0 1..372 1..372
PcLiP10_RP78 538 0 1..369 1..367
PcarLiP01 538 0 1..369 1..370
PgigLiP02 535 0 1..368 1..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1416538..1416755 218 N° 2 1416808..1416864 57 N° 3 1416926..1417182 257 N° 4 1417242..1417320 79
N° 5 1417374..1417499 126 N° 6 1417554..1417669 116 N° 7 1417730..1417905 176 N° 8 1417967..1418031 65
N° 9 1418086..1418110 25  
join(1416538..1416755,1416808..1416864,1416926..1417182,1417242..1417320,1417374 ..1417499,1417554..1417669,1417730..1417905,1417967..1418031,1418086..1418110)


exon

Literature and cross-references PcLiP04_RP78 (PcLiPD_RP78)
DNA ref. JGI genome:   scaffold_11 (1416538..1418110)
mRNA ref. JGI transcript:   6811
Protein sequence: PcLiP04_RP78 (PcLiPD_RP78)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372 (351)
PWM (Da):   %s   39336.47 (37138.2)  
PI (pH):   %s   4.76 (4.68) Peptide Signal:   %s   cut: 22 range:22-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLLAALSVALTLQVTQAAPNLDKRVACPDGVHTASNAACCAWFPVLDDIQQNLFHGGQCGAEAHEALRMVFHDSIAISPKLQSQGKFGGGGADGSIITFSSIETTYHPNIGLDEVVAIQKPFIAKHGVTPGDFIAFAGAVGVSNCPGAPQMQFFLGRPEATQAAPDGLVPEPHTIDQVLARMLDAGGFDEIETVWLLSAHSIAAANDVDPTISGLPFDSTPGQFDSQFFVETQLRGTAFPGKTGIQGTVMSPLKGEMRLQTDHLFARDSRTACEWQSFNNQTKLQEDFQFIFTALSTLGHDMNAMIDCSEVIPAPKPVNFGPSFFPAGKTHADIEQCASTPFPTLITAPGPSASVARIPPPPSPN

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Strain="RP78".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCAAGCAGCTCCTCGCAGCCCTCTCCGTCGCCCTGACCCTTCAGGTCACCCAAGCTGCCCCGAACCTCGACAAGCGCGTCGCTTGCCCCGACGGCGTGCACACTGCTTCCAAC
GCGGCGTGCTGTGCATGGTTCCCGGTCCTCGATGATATCCAGCAGAACCTCTTCCACGGTGGCCAGTGCGGTGCCGAGGCCCACGAGGCCCTTCGTAT
GTAAGTCGCTGCGGACTCATGG
TGTCCAAGCGTAGGGGCTAACCCGGTGCAGGGTCTTCCACGACTCCATCGCTATCTCGCCCAAGCTTCAGTCGCAGGGCAAGTTTGGGTACGCACTCCAGCTCATGCACGGCCAGGTGCA
CTGCTAACTTTGAGCTCCCTCTTCACAGCGGCGGCGGCGCGGACGGCTCGATCATCACCTTCTCCTCGATCGAGACCACGTACCACCCGAACATCGGCCTCGACGAGGTCGTCGCCATCC
AGAAGCCGTTCATCGCGAAGCACGGCGTCACGCCCGGCGACTTCATCGCGTTCGCCGGTGCCGTCGGCGTGAGCAACTGCCCGGGCGCGCCGCAGATGCAGTTCTTCCTCGGCCGCCCCG
AGGCGACGCAGGCTGCCCCCGACGGTCTCGTGCCCGAGCCCTTCC
GTGAGCAGCAGTCAGCGGTAGAGCAAACAATCGAGTTGCTGACTCTCCATGACCGGCAGACACCATCGATCAGGT
TCTCGCTCGCATGCTTGATGCTGGCGGCTTCGACGAGATCGAGACTGTCTGGCTGCTCTCTGC
GTGGGTGGACTCCTCGCTGGTGTCCTTAACGCTCTGACCCTGCTTCCCACCAGCCAC
TCCATCGCGGCTGCGAACGACGTCGACCCGACCATCTCCGGCCTGCCGTTCGACTCCACCCCTGGCCAGTTCGACTCCCAGTTCTTCGTCGAGACGCAGCTCCGCGGTACCGCATTCCCT
GG
GTGAGTGGTCCCGCAGCAGCTTCTGCTGTTTCCGTCACTAAACCATCATTGCAGCAAGACCGGCATCCAGGGCACCGTCATGTCCCCGCTCAAGGGCGAGATGCGTCTGCAGACGGAC
CACTTGTTCGCGCGCGACTCGCGCACGGCGTGCGAGTGGCAGTCCTTCGTCA
GTGCGTAACCCATTCTCTCACTCATTGCGAGAGCCCGACGCTGAGACGCCGCACACGCAGACAACCAG
ACGAAGCTGCAGGAGGACTTCCAGTTCATCTTCACGGCGCTCTCGACCCTCGGCCACGACATGAACGCCATGATCGACTGCTCCGAGGTCATCCCCGCGCCCAAGCCCGTCAACTTCGGC
CCGTCGTTCTTCCCCGCCGGCAAGACGCACGCCGACATCGAGCAGGCC
GTAAGTGCTCGTTTTCCACTGGTATGTCTTTGTTTGAGTACGGGGCTGACGAGTGTGCCAGTGCGCGTCCAC
GCCGTTCCCGACGCTCATCACCGCCCCTGGTCCCTCTGCGTCCGTCGCTCGCAT
GTAAGTGTTCGTGCTCTCGTGAAGAGAAAGTCTCTCTGACATCGTCTGCAACAGCCCGCCGCCGCC
GTCCCCCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCAAGCAGCTCCTCGCAGCCCTCTCCGTCGCCCTGACCCTTCAGGTCACCCAAGCTGCCCCGAACCTCGACAAGCGCGTCGCTTGCCCCGACGGCGTGCACACTGCTTCCAAC
GCGGCGTGCTGTGCATGGTTCCCGGTCCTCGATGATATCCAGCAGAACCTCTTCCACGGTGGCCAGTGCGGTGCCGAGGCCCACGAGGCCCTTCGTAT
GGTCTTCCACGACTCCATCGCT
ATCTCGCCCAAGCTTCAGTCGCAGGGCAAGTTTGG
CGGCGGCGGCGCGGACGGCTCGATCATCACCTTCTCCTCGATCGAGACCACGTACCACCCGAACATCGGCCTCGACGAGGTCGTC
GCCATCCAGAAGCCGTTCATCGCGAAGCACGGCGTCACGCCCGGCGACTTCATCGCGTTCGCCGGTGCCGTCGGCGTGAGCAACTGCCCGGGCGCGCCGCAGATGCAGTTCTTCCTCGGC
CGCCCCGAGGCGACGCAGGCTGCCCCCGACGGTCTCGTGCCCGAGCCCTTCC
ACACCATCGATCAGGTTCTCGCTCGCATGCTTGATGCTGGCGGCTTCGACGAGATCGAGACTGTCTGG
CTGCTCTCTGC
CCACTCCATCGCGGCTGCGAACGACGTCGACCCGACCATCTCCGGCCTGCCGTTCGACTCCACCCCTGGCCAGTTCGACTCCCAGTTCTTCGTCGAGACGCAGCTCCGC
GGTACCGCATTCCCTGG
CAAGACCGGCATCCAGGGCACCGTCATGTCCCCGCTCAAGGGCGAGATGCGTCTGCAGACGGACCACTTGTTCGCGCGCGACTCGCGCACGGCGTGCGAGTGG
CAGTCCTTCGTCA
ACAACCAGACGAAGCTGCAGGAGGACTTCCAGTTCATCTTCACGGCGCTCTCGACCCTCGGCCACGACATGAACGCCATGATCGACTGCTCCGAGGTCATCCCCGCG
CCCAAGCCCGTCAACTTCGGCCCGTCGTTCTTCCCCGCCGGCAAGACGCACGCCGACATCGAGCAGGCC
TGCGCGTCCACGCCGTTCCCGACGCTCATCACCGCCCCTGGTCCCTCTGCG
TCCGTCGCTCGCAT
CCCGCCGCCGCCGTCCCCCAACTAA

Retrieve as FASTA