Entry information : PcLiP09_RP78 (PcLiPI_RP78)
Entry ID 6833
Creation 2009-05-29 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-29 (Christophe Dunand)
Peroxidase information: PcLiP09_RP78 (PcLiPI_RP78)
Name (synonym) PcLiP09_RP78 (PcLiPI_RP78)
Class Lignin peroxidase    [Orthogroup: LiP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcLiP09_RP78
start..stop
S start..stop
PcLiP09_ME446 746 0 1..372 1..372
PcLiP07_RF78 691 0 1..372 1..372
PsoLiP07 668 0 1..372 1..373
PcLiP08_RP78 660 0 1..372 1..368
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 443344..443404 61 N° 2 443137..443290 154 N° 3 443030..443086 57 N° 4 442759..442973 215
N° 5 442665..442706 42 N° 6 442533..442611 79 N° 7 442059..442482 424 N° 8 441939..442003 65
N° 9 441862..441883 22  
complement(join(441862..441883,441939..442003,442059..442482,442533..442611,4426 65..442706,442759..442973,443030..443086,443137..443290,443344..443404))


exon

Literature and cross-references PcLiP09_RP78 (PcLiPI_RP78)
DNA ref. JGI genome:   scaffold_19 (443404..441862)
mRNA ref. JGI transcript:   121806 [Incorrect splicing]
Protein sequence: PcLiP09_RP78 (PcLiPI_RP78)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372 (351)
PWM (Da):   %s   39218.31 (37119.1)  
PI (pH):   %s   4.08 (4.04) Peptide Signal:   %s   cut: 22 range:22-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLVAAISLALSISAVQGAAVKEKRATCSNGATVGDESCCAWFDVLDDIQENLFQGAQCGAEAHESIRLVFHDAIAISPAMEAQGQFGGGGADGSIIIFDTIETAFHPNIGLDEIVNLQKPFIAKHGVTPGDFIAFAGAVALSNCPGTPQMNFFTGRAATQAAPDGLVPEPFHTVDQLINRVNDAGQFDELELVWMLSAHSVAAVNDVDPTIQGLPFDSTPGIFDSQFFVETQLRGTAFPGSGGNQGEVESPLPGEIRIQTDHTLARDPRTACEWQSFVANQSKLVSDFQFIFLALTQLGQDPNAMTDCSDVIPISKPIPGDLPFSFFPAGKTAADVEQCAETPFPSLTTLPGPETSVQRIPPPPGA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Incorrect prediction from JGI.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGCAACTCGTCGCCGCAATTTCTCTAGCTCTTTCCATCTCTGCGGTCCAAGGTGCGCCTTCTGTTACCACCGAGCGACAGCCAGAGTCCTGACCTCACTGCCAGGTGCCG
CCGTCAAGGAGAAGCGTGCCACTTGCTCGAATGGCGCCACTGTTGGCGACGAATCGTGCTGCGCGTGGTTCGATGTTCTCGACGACATCCAGGAGAACTTGTTCCAAGGCGCTCAGTGCG
GCGCTGAGGCTCATGAGTCGATTCGCCT
GTAGGCACTCCTACTCCCTCTGTCATGAGTCTCGGCTCACCCAGTCGTAGCGTCTTCCACGATGCAATTGCCATCTCGCCCGCCATGGAGGC
GCAGGGCCAGTTCGG
GCAAGTATCGCGCATGTGGCACATTTTACCAACACTCGCTGACCCATCTTCTCTAGCGGTGGAGGTGCTGATGGCTCTATCATCATCTTCGACACGATTGAGACT
GCGTTCCACCCGAACATTGGTCTCGACGAGATCGTCAACCTGCAGAAGCCGTTCATCGCCAAGCACGGTGTGACACCCGGAGACTTCATTGCTTTCGCGGGCGCAGTCGCCCTCAGCAAC
TGCCCTGGTACTCCCCAGATGAACTTCTTCACCGGTCGTGCTCCCG
GTATGTCTTAAAGTCTGACAAAACTAATACTCGACTGACTTTGCCTGTGTAGCCACCCAAGCCGCTCCAGACGG
CCTGGTCCCGGAGCCATTCC
GTACGTTCATTGCCAGTTCTGCCTATCGTTGCTGAAGCTGAAAACCCCTTCAGACACCGTCGACCAGCTCATTAACCGTGTCAACGACGCCGGTCAGTTC
GATGAGCTCGAGCTCGTTTGGATGCTTTCCGC
GTGAGTGCTCATGCGTCCGGCCCGATAAACTCGGCTGACACCTGCTACAGCCACTCCGTTGCTGCAGTCAACGACGTGGACCCGACCA
TCCAGGGCCTGCCCTTCGACTCCACTCCCGGCATTTTCGACTCCCAGTTCTTCGTCGAGACTCAGCTCCGTGGTACCGCATTCCCCGGCTCTGGCGGAAACCAGGGTGAGGTCGAATCTC
CGCTCCCGGGCGAGATCCGCATCCAGACCGACCACACGCTCGCTCGCGACCCCCGCACGGCGTGCGAGTGGCAATCGTTCGTCGCGAACCAGTCCAAGCTTGTCTCCGACTTCCAGTTCA
TCTTCCTCGCCCTCACCCAGCTCGGCCAGGACCCGAACGCGATGACCGACTGCTCCGACGTCATCCCGATCTCGAAGCCCATCCCCGGAGACCTTCCGTTCTCGTTCTTCCCCGCCGGCA
AGACCGCTGCCGATGTCGAGCAGGCT
GTGCGTAGCTGCCCTTTGTATTACTTCTCTATTACTGACTGACCGCCTCCTGTAGTGCGCCGAGACCCCCTTCCCATCGCTCACTACCCTTCCG
GGTCCCGAGACCTCCGTCCAGCGCAT
GTGCGTAGCTTTCGGATCCGCTGGTAGTTACTGGAATACTAACAATGCTCTCCAGCCCGCCGCCCCCTGGTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGCAACTCGTCGCCGCAATTTCTCTAGCTCTTTCCATCTCTGCGGTCCAAGGTGCCGCCGTCAAGGAGAAGCGTGCCACTTGCTCGAATGGCGCCACTGTTGGCGACGAA
TCGTGCTGCGCGTGGTTCGATGTTCTCGACGACATCCAGGAGAACTTGTTCCAAGGCGCTCAGTGCGGCGCTGAGGCTCATGAGTCGATTCGCCT
CGTCTTCCACGATGCAATTGCCATC
TCGCCCGCCATGGAGGCGCAGGGCCAGTTCGG
CGGTGGAGGTGCTGATGGCTCTATCATCATCTTCGACACGATTGAGACTGCGTTCCACCCGAACATTGGTCTCGACGAGATCGTCAAC
CTGCAGAAGCCGTTCATCGCCAAGCACGGTGTGACACCCGGAGACTTCATTGCTTTCGCGGGCGCAGTCGCCCTCAGCAACTGCCCTGGTACTCCCCAGATGAACTTCTTCACCGGTCGT
GCTCCCG
CCACCCAAGCCGCTCCAGACGGCCTGGTCCCGGAGCCATTCCACACCGTCGACCAGCTCATTAACCGTGTCAACGACGCCGGTCAGTTCGATGAGCTCGAGCTCGTTTGGATG
CTTTCCGC
CCACTCCGTTGCTGCAGTCAACGACGTGGACCCGACCATCCAGGGCCTGCCCTTCGACTCCACTCCCGGCATTTTCGACTCCCAGTTCTTCGTCGAGACTCAGCTCCGTGGT
ACCGCATTCCCCGGCTCTGGCGGAAACCAGGGTGAGGTCGAATCTCCGCTCCCGGGCGAGATCCGCATCCAGACCGACCACACGCTCGCTCGCGACCCCCGCACGGCGTGCGAGTGGCAA
TCGTTCGTCGCGAACCAGTCCAAGCTTGTCTCCGACTTCCAGTTCATCTTCCTCGCCCTCACCCAGCTCGGCCAGGACCCGAACGCGATGACCGACTGCTCCGACGTCATCCCGATCTCG
AAGCCCATCCCCGGAGACCTTCCGTTCTCGTTCTTCCCCGCCGGCAAGACCGCTGCCGATGTCGAGCAGGCT
TGCGCCGAGACCCCCTTCCCATCGCTCACTACCCTTCCGGGTCCCGAG
ACCTCCGTCCAGCGCAT
CCCGCCGCCCCCTGGTGCTTAA

Retrieve as FASTA