Entry information : CnKat04_JEC21
Entry ID 6856
Creation 2009-06-22 (Christophe Dunand)
Last sequence changes 2009-06-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: CnKat04_JEC21
Name CnKat04_JEC21
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnKat04_JEC21
start..stop
S start..stop
CnKat04_B-3501A 1051 0 1..498 1..498
CnKat04_grubiiH99 1031 0 1..498 1..498
NcKat04 630 0 5..496 6..489
SschKat01 578 0 8..488 5..488
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22133..22169 37 N° 2 22219..22583 365 N° 3 22641..22733 93 N° 4 22783..22790 8
N° 5 22840..22963 124 N° 6 23014..23301 288 N° 7 23363..23447 85 N° 8 23497..23916 420
N° 9 23970..24046 77  
join(22133..22169,22219..22583,22641..22733,22783..22790,22840..22963,23014..233 01,23363..23447,23497..23916,23970..24046)


exon

Literature and cross-references CnKat04_JEC21
DNA ref. JGI genome:   NC_006681 (22133..24046)
Protein sequence: CnKat04_JEC21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   498
PWM (Da):   %s   55787.43  
PI (pH):   %s   7.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTEKTPTYTLSEGCPIADATTAQRLGSCPVKGLMLMQDTQLIETLAHFSRERIPERTVHASAVGAWGEFEVTHDNSDITSAAFLNGIGKKSKVLMRISTVGPEAGTAETVRDVRGWSMKIFTEEGNQDFVFNSPVFFIRDPIKFPSVNRSHKRHPAKHTADSSMFWDFHNNNPEGTHAIMMYFSNRGLPYSLRQINSYSGHTYKLTKDGSFVYVKLHFKSNQGVKGMTQAEGVRTAGEAPDFHTTDMWDAIERGDYPTWTLYAQVMKPEEAENYRWNIFDMTKVWPHKDFPLRPLGKLTLNRNPENYFSDIEQAAFSPSTMVPGVAPSGDPMLQARMFAYPDAARYRLGVNYQQLPCNRPVSEVYAPYQRDGAMRYMTNYGGDPNYVRSSLKEVNFKGQLGAKGHSTGGNEKHNEWVGRVAAYTSEVTDEDYVQARMFWEVLGKAGDQEDLITNVSCHLSKAIPSVQKGAVEIFAKVNVDLAKSIEDRLAELNKGK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 8 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGAGAAAACACCGACGTACACCCTGTCCGAAGGTCCGTCGGATCATTCCAGCCAAAACGCTATGGTTGCTGACCAGTGTAGGATGCCCTATCGCGGATGCTACGACCGCCCAGCG
TCTGGGCAGTTGCCCCGTTAAGGGCCTGATGTTGATGCAGGACACCCAGCTCATCGAGACTCTGGCCCACTTCAGTAGGGAGCGCATTCCCGAGCGTACCGTGCATGCTTCTGCCGTTGG
TGCATGGGGCGAATTTGAAGTAACTCACGACAATTCCGACATCACTTCGGCTGCTTTCCTCAATGGGATTGGCAAAAAGTCCAAGGTTCTTATGCGTATCTCCACTGTGGGACCGGAGGC
TGGCACAGCCGAGACTGTTCGGGATGTGAGGGGCTGGTCGATGAAGATCTTCACTGAAGAGGGCAACCAAGACTTTGTCTTCAACAGCATT
GTATGTGGCCGACTCCGTTCTCCATGTGC
TGGTTGTATGGGTGCTGAAGTTCTCTAGCCGGTGTTCTTCATCCGAGACCCAATCAAATTCCCCTCTGTTAACCGATCTCACAAGCGTCATCCCGCAAAGCATACCGCCGACTCTTCTAT
G
GTGAGTGGTTGAACTTCCACGTTTGTTGCCCCAGCTGATTATTATGCAGTTCTGGGAGTGCGTTTCGTTTTACATCCACGACATGGTGACCATACTTACAGTTTAGCTTTCACAACAAC
AACCCCGAGGGAACTCATGCCATCATGATGTATTTTAGCAATCGAGGGCTGCCGTATTCACTAAGGCAAATCAACTCCTACAGTGGTCACACTTACAAGCTCACCAAATCG
GTTTGTGCC
TCATTTTTTCAAAACTAGCGAATCATTGACTCTTTCTTTAGGACGGCTCTTTTGTTTATGTCAAACTCCACTTCAAATCCAATCAAGGTGTCAAGGGCATGACGCAGGCCGAAGGCGTAC
GCACTGCCGGCGAAGCACCCGATTTCCACACGACCGATATGTGGGATGCTATCGAGCGGGGCGACTACCCTACTTGGACGTTGTATGCTCAAGTCATGAAGCCCGAAGAGGCTGAAAACT
ACCGCTGGAATATCTTCGATATGACCAAGGTTTGGCCCCACAAAGACTTCCCCCTCAGACCACTTGGTAAATTGACCCTAAACCGTAAC
GTGAGTGTTATCTGGGATGTTGTCTGGTTCA
TAGACTAATCAATCTTTTTCTGACGAATAGCCCGAAAACTACTTCTCAGACATTGAGCAGGCTGCCTTTTCGCCATCGACAATGGTGCCGGGCGTTGCGCCCTCCGGAGATCCAAGTGGG
CTGAGTCCTTTGTTTAAAGTACTGTATCCGCTGACTCCAATAAGTGCTGCAAGCTAGGATGTTTGCCTACCCCGATGCCGCTCGATACCGCCTCGGTGTCAACTACCAGCAACTTCCGTG
CAATCGGCCCGTCAGTGAGGTTTATGCGCCCTACCAGCGTGACGGTGCGATGCGCTACATGACCAATTACGGAGGTGATCCCAATTATGTGCGATCTTCTCTCAAGGAAGTCAACTTCAA
GGGTCAATTGGGCGCAAAAGGCCATTCCACTGGGGGCAACGAGAAACACAATGAATGGGTCGGTCGAGTTGCGGCGTACACATCCGAGGTAACGGATGAGGATTACGTCCAAGCTCGCAT
GTTCTGGGAGGTTCTTGGCAAAGCTGGCGACCAAGAGGACTTGATCACCAATGTCTCGTGTCATCTAAGCAAGGCTATCCCGTCGGTGCAGAAAGGAGCTGTCG
GTAAGTGGTCAACGGA
GAGTGTTTTGCGGCACGAGATGTTAACCTGATTACAGAAATCTTCGCCAAGGTGAATGTTGATTTGGCCAAGTCCATCGAAGACCGTTTGGCTGAGCTCAACAAAGGAAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGAGAAAACACCGACGTACACCCTGTCCGAAGGATGCCCTATCGCGGATGCTACGACCGCCCAGCGTCTGGGCAGTTGCCCCGTTAAGGGCCTGATGTTGATGCAGGACACCCAG
CTCATCGAGACTCTGGCCCACTTCAGTAGGGAGCGCATTCCCGAGCGTACCGTGCATGCTTCTGCCGTTGGTGCATGGGGCGAATTTGAAGTAACTCACGACAATTCCGACATCACTTCG
GCTGCTTTCCTCAATGGGATTGGCAAAAAGTCCAAGGTTCTTATGCGTATCTCCACTGTGGGACCGGAGGCTGGCACAGCCGAGACTGTTCGGGATGTGAGGGGCTGGTCGATGAAGATC
TTCACTGAAGAGGGCAACCAAGACTTTGTCTTCAACAGCATT
CCGGTGTTCTTCATCCGAGACCCAATCAAATTCCCCTCTGTTAACCGATCTCACAAGCGTCATCCCGCAAAGCATACC
GCCGACTCTTCTATG
TTCTGGGACTTTCACAACAACAACCCCGAGGGAACTCATGCCATCATGATGTATTTTAGCAATCGAGGGCTGCCGTATTCACTAAGGCAAATCAACTCCTACAGT
GGTCACACTTACAAGCTCACCAAATCG
GACGGCTCTTTTGTTTATGTCAAACTCCACTTCAAATCCAATCAAGGTGTCAAGGGCATGACGCAGGCCGAAGGCGTACGCACTGCCGGCGAA
GCACCCGATTTCCACACGACCGATATGTGGGATGCTATCGAGCGGGGCGACTACCCTACTTGGACGTTGTATGCTCAAGTCATGAAGCCCGAAGAGGCTGAAAACTACCGCTGGAATATC
TTCGATATGACCAAGGTTTGGCCCCACAAAGACTTCCCCCTCAGACCACTTGGTAAATTGACCCTAAACCGTAAC
CCCGAAAACTACTTCTCAGACATTGAGCAGGCTGCCTTTTCGCCA
TCGACAATGGTGCCGGGCGTTGCGCCCTCCGGAGATCCAA
TGCTGCAAGCTAGGATGTTTGCCTACCCCGATGCCGCTCGATACCGCCTCGGTGTCAACTACCAGCAACTTCCGTGCAAT
CGGCCCGTCAGTGAGGTTTATGCGCCCTACCAGCGTGACGGTGCGATGCGCTACATGACCAATTACGGAGGTGATCCCAATTATGTGCGATCTTCTCTCAAGGAAGTCAACTTCAAGGGT
CAATTGGGCGCAAAAGGCCATTCCACTGGGGGCAACGAGAAACACAATGAATGGGTCGGTCGAGTTGCGGCGTACACATCCGAGGTAACGGATGAGGATTACGTCCAAGCTCGCATGTTC
TGGGAGGTTCTTGGCAAAGCTGGCGACCAAGAGGACTTGATCACCAATGTCTCGTGTCATCTAAGCAAGGCTATCCCGTCGGTGCAGAAAGGAGCTGTCG
AAATCTTCGCCAAGGTGAAT
GTTGATTTGGCCAAGTCCATCGAAGACCGTTTGGCTGAGCTCAACAAAGGAAAGTAA

Retrieve as FASTA