Entry information : SmPrx13-1_0 (SmPrx13a_0)
Entry ID 6987
Creation 2009-09-30 (Paula Nunes)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx13-1_0 (SmPrx13a_0)
Name (synonym) SmPrx13-1_0 (SmPrx13a_0)
Class Class III peroxidase    [Orthogroup: Prx047]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx13-1_0
start..stop
S start..stop
SmPrx14-1_0 687 0 1..332 1..332
SmPrx13-2_57 685 0 1..332 1..332
SmPrx14-2_57 645 0 1..332 1..332
SmPrx30-2_131 420 2e-148 7..332 10..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6891839..6892066 228 N° 2 6892121..6892318 198 N° 3 6892377..6892539 163 N° 4 6892619..6893028 410
join(6891839..6892066,6892121..6892318,6892377..6892539,6892619..6893028)


exon

Literature and cross-references SmPrx13-1_0 (SmPrx13a_0)
Literature Richardson,P., Lucas,S., Rokhsar,D., Wang,M. and Lindquist,E.A. DOE Joint Genome Institute Selaginella moellendorffii EST project. Unpublished (2008)
DNA ref. Phytozome 12:   scaffold_0 (6891839..6893028)
mRNA ref. JGI transcript:   75799 [Incorrect splicing]
Protein sequence: SmPrx13-1_0 (SmPrx13a_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (310)
PWM (Da):   %s   36347.28 (33981.9) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.06 (9.06) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METWRGSVLVLLLLSLSLGILAHGESGGRKHGYHSYSRSCPQAERIIRDTLSKHAGWDRTIPAGVLRLHFHDCFVDGCDGSILLDSTPTDGTKVEKLSLPNFMSARGFEVIEEAKQRLEAACPGVVSCADTLAIAARDSTVMLGGKYYQVPTGRYDGRVSSQERGNTLPSPFGDASALIQNFKERGLSVQDLVVLSGGHTLGTAGCATFSNRLDNFTKTGKPDPTINPRYLSHLRRQCPAPGSPNRVALDKGSEFVFDNSYHKNLARRNGVLTSDQVLNEDSRTSHYVKNFAHKQHDFLSQFAASMVKMGYIGWKNKHNGEIRRVCSMVNTH

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Incorrect transcript prediction from JGI (no intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTTGGAGAGGGAGCGTTTTGGTTTTGCTCCTGCTGTCACTGAGCTTGGGTATCTTGGCTCACGGTGAGAGTGGAGGACGCAAGCATGGCTACCACAGCTACTCGAGATCTTGT
CCTCAGGCCGAGAGGATCATAAGGGACACTCTAAGCAAGCACGCCGGTTGGGACAGGACGATACCAGCAGGAGTTCTTCGCTTGCACTTCCACGACTGTTTCGTCGAC
GTGAGTAGCTTT
ACAAGATTTAAATTCTGGTTTTCTAACTTTGCTGTTCTCCAGGGCTGTGATGGATCGATTCTTCTCGACTCAACTCCCACCGACGGAACTAAAGTGGAAAAATTGTCCCTTCCAAACTTC
ATGTCCGCCAGGGGCTTCGAGGTGATTGAGGAAGCAAAGCAGAGGTTGGAAGCAGCTTGTCCTGGAGTTGTCTCCTGTGCCGACACTCTCGCCATAGCTGCCAGAGACTCGACCGTCATG
GTAAGCTTAGCATCTTTTGAGAAACGCTGAATCAAGTTCTAAGACGTTGTCACTGCAGCTTGGAGGAAAGTATTACCAAGTCCCAACCGGACGCTACGACGGAAGAGTTTCCAGCCAGGA
ACGTGGCAACACCTTACCATCCCCGTTTGGCGATGCCTCGGCTCTCATTCAAAACTTCAAGGAGCGCGGCTTGTCAGTCCAGGACCTCGTCGTTCTCTCAG
GTACGAATCGATTTCAACT
TCCATCTCCTTCCCTCCAGTTTGTAAGTAGGCATTAACGCTACTCCCTTGCAAACCACAGGTGGTCACACTCTTGGTACCGCCGGCTGCGCCACATTCAGCAATCGTTTGGACAACTTTA
CGAAAACTGGCAAGCCGGACCCGACCATCAATCCCAGATACCTCTCTCATCTCCGGAGGCAGTGCCCAGCACCGGGGTCGCCAAACCGTGTGGCGCTGGACAAAGGCTCGGAGTTTGTGT
TCGACAACAGCTACCACAAGAACTTGGCCAGGAGAAACGGGGTCCTCACGTCGGATCAAGTTCTCAACGAGGACTCGAGAACAAGTCACTACGTCAAGAACTTTGCGCACAAGCAGCACG
ACTTTTTGTCGCAGTTTGCGGCCTCGATGGTGAAGATGGGATACATTGGGTGGAAGAACAAGCACAATGGGGAAATCAGGAGGGTGTGCTCCATGGTAAACACCCATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTTGGAGAGGGAGCGTTTTGGTTTTGCTCCTGCTGTCACTGAGCTTGGGTATCTTGGCTCACGGTGAGAGTGGAGGACGCAAGCATGGCTACCACAGCTACTCGAGATCTTGT
CCTCAGGCCGAGAGGATCATAAGGGACACTCTAAGCAAGCACGCCGGTTGGGACAGGACGATACCAGCAGGAGTTCTTCGCTTGCACTTCCACGACTGTTTCGTCGAC
GGCTGTGATGGA
TCGATTCTTCTCGACTCAACTCCCACCGACGGAACTAAAGTGGAAAAATTGTCCCTTCCAAACTTCATGTCCGCCAGGGGCTTCGAGGTGATTGAGGAAGCAAAGCAGAGGTTGGAAGCA
GCTTGTCCTGGAGTTGTCTCCTGTGCCGACACTCTCGCCATAGCTGCCAGAGACTCGACCGTCATG
CTTGGAGGAAAGTATTACCAAGTCCCAACCGGACGCTACGACGGAAGAGTTTCC
AGCCAGGAACGTGGCAACACCTTACCATCCCCGTTTGGCGATGCCTCGGCTCTCATTCAAAACTTCAAGGAGCGCGGCTTGTCAGTCCAGGACCTCGTCGTTCTCTCAG
GTGGTCACACT
CTTGGTACCGCCGGCTGCGCCACATTCAGCAATCGTTTGGACAACTTTACGAAAACTGGCAAGCCGGACCCGACCATCAATCCCAGATACCTCTCTCATCTCCGGAGGCAGTGCCCAGCA
CCGGGGTCGCCAAACCGTGTGGCGCTGGACAAAGGCTCGGAGTTTGTGTTCGACAACAGCTACCACAAGAACTTGGCCAGGAGAAACGGGGTCCTCACGTCGGATCAAGTTCTCAACGAG
GACTCGAGAACAAGTCACTACGTCAAGAACTTTGCGCACAAGCAGCACGACTTTTTGTCGCAGTTTGCGGCCTCGATGGTGAAGATGGGATACATTGGGTGGAAGAACAAGCACAATGGG
GAAATCAGGAGGGTGTGCTCCATGGTAAACACCCATTAA

Retrieve as FASTA