Entry information : SmPrx22-2_67 (SmPrx22b_67)
Entry ID 6993
Creation 2009-12-18 (Christophe Dunand)
Last sequence changes 2009-12-18 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: SmPrx22-2_67 (SmPrx22b_67)
Name (synonym) SmPrx22-2_67 (SmPrx22b_67)
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx22-2_67
start..stop
S start..stop
SmPrx22-1_79 682 0 1..338 1..341
SmPrx02-1_122 361 5.87e-125 40..337 29..327
SmPrx02-2_114 358 1.12e-123 40..337 29..327
SmPrx01-1_122 318 4.56e-108 21..338 5..322
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6993' 'join(28879..28994,29406..29535,29589..29783,29855..30020,30102..30511)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28879..28994 114 N° 2 29406..29535 128 N° 3 29589..29783 193 N° 4 29855..30020 164
N° 5 30102..30511 408  
join(28879..28994,29406..29535,29589..29783,29855..30020,30102..30511)


exon

Literature and cross-references SmPrx22-2_67 (SmPrx22b_67)
DNA ref. Phytozome 12:   scaffold_67 (28879..30511)
mRNA ref. JGI transcript:   122100 [Incorrect prediction]
Protein sequence: SmPrx22-2_67 (SmPrx22b_67)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (305)
PWM (Da):   %s   36951.87 (33417.1)  
PI (pH):   %s   8.35 (8.39) Peptide Signal:   %s   cut: 34 range:34-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHLICGGGGGGVFFHRSCALWLLVILLPQCWVASQYEGEGFYDQSCPSAESVVRRTMVDSFRRNPLLAAGILRLFFHDCFVGCDGSVLLDRKPGGPIPEKESDVNNNSITGFRVIDDAKKRLERMCPGVVSCSDILALAARDAVWISGGPRWSVPTGR
LDGRVSLATEADNEIPPPDLRIRDLRKAFLAKGLNTHDVVTLS
GAHTIGRAHCPAFEDRLYNFSATNAPDPTVNLSLLDSLQKICPRVGNTTFTVSLDRQTQVLFDNSYYVQILASNGLL
QTDQQLLFDASTAGLVRAYAADSSMFFRAFAKAMIKLSRVGLKAPGEGEIRKHCRRVNP

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns and extra 5' intron). No ESTs. Incorrect transcript prediction from JGI (incorrect PS and splicing error for intron 3). PS prediction with an extra intron.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTTGATCTGTGGTGGTGGTGGTGGTGGTGTGTTCTTCCACAGATCTTGCGCATTGTGGCTGCTCGTAATTCTCCTCCCGCAATGTTGGGTGGCTTCTCAATACGAAGGAGAGAGC
AAGGGATGTTCTACTCCAACAATGAACAGGGAATGTTTTATCGTGATGATGATCAATCATGGTCCGGTGGTGCATTTCAAGGAGGAGCGTTTCGAGACGATCGTGAGCGGTACTGGCGGG
AGTCAAATCCAGACCCGTATCCAGATCCAAACCCCTCGCAACTTCAGCAGCCCGATCAGGTTGTGTCTCAGCAACAGATTCCGAATCAACCTCCGCAACAGATTCCGCAGCAGGTGCAGA
ATCCGAACCAGTTTCCGCAGCAGGTTCAGAACCAGAACCCAAATCAGCCGCAAGTTCAGAACCAGAACCAGAATCAACAACAAGTTCAGAGCCAGAACCAGAATCAACAACAAGCTCAGA
ACCAGAACCAGAATCAACAACAAGCTCAGAACCAGAACCAAGTGGTCAGAGGATTTTATGACCAGAGCTGCCCATCAGCGGAATCCGTCGTCCGGAGGACCATGGTGGACAGCTTCCGGC
GGAACCCGCTGCTGGCCGCCGGAATCCTCCGGCTCTTCTTCCATGACTGCTTTGTCCGA
GAGTAAGTTGGAGACTTTTGGAAAAGATTGATCGATCTGTAACTCGACAATGCAGGGTTGT
GATGGATCGGTGCTGCTGGATCGAAAACCCGGCGGACCCATCCCCGAAAAGGAGAGCGACGTGAACAACAACTCCATCACTGGCTTCCGGGTGATTGACGACGCCAAGAAGCGCTTGGAG
CGGATGTGCCCGGGAGTCGTGTCGTGCTCGGACATCCTCGCACTGGCTGCTCGAGACGCCGTTTGGATC
TCGTAAGTCCTGATAGAAAAGAAAACTTTCCATTTCCTTTTAGTGACACGA
AATGCCTTCCGGGTTAGAGCAGAGTGGAGGACCTCGCTGGAGTGTCCCGACGGGACGTCTGGACGGGCGAGTCTCGCTGGCGACGGAAGCCGATAACGAGATTCCACCACCGGATCTCCG
AATCCGGGACTTGAGAAAGGCATTTCTCGCCAAGGGCCTCAACACCCACGACGTCGTCACCCTCTCAG
AGGCTAGTAAAACATTTTCTCTTTAATTATACAGCGTTTGCCTAGTTTCGGC
ATTTGCTAAAGATTGTAAAGTTCTTTCACAGGCGCGCACACTATCGGTCGAGCACACTGCCCCGCCTTTGAGGACCGCCTCTACAACTTCTCCGCAACAAACGCGCCAGATCCCACCGTC
AATCTGTCGCTGCTGGACTCGCTCCAAAAGATTTGCCCCAGGGTTGGGAATACCACCTTCACGGTGAGCCTGGATCGCCAGACCCAAGTCCTGTTTGACAACAGCTACTACGTCCAGATC
CTGGCCAGCAATGGGCTCCTCCAGACCGATCAGCAGCTCCTCTTCGACGCCTCCACCGCGGGGTTGGTGCGAGCGTACGCCGCCGATTCGTCCATGTTCTTCCGCGCCTTCGCCAAGGCC
ATGATCAAGCTCAGCAGGGTGGGTTTGAAAGCTCCTGGCGAGGGCGAGATCCGGAAGCACTGCCGTCGTGTAAATCCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTTGATCTGTGGTGGTGGTGGTGGTGGTGTGTTCTTCCACAGATCTTGCGCATTGTGGCTGCTCGTAATTCTCCTCCCGCAATGTTGGGTGGCTTCTCAATACGAAGGAGAAGGA
TTTTATGACCAGAGCTGCCCATCAGCGGAATCCGTCGTCCGGAGGACCATGGTGGACAGCTTCCGGCGGAACCCGCTGCTGGCCGCCGGAATCCTCCGGCTCTTCTTCCATGACTGCTTT
GTCCGA
GGTTGTGATGGATCGGTGCTGCTGGATCGAAAACCCGGCGGACCCATCCCCGAAAAGGAGAGCGACGTGAACAACAACTCCATCACTGGCTTCCGGGTGATTGACGACGCCAAG
AAGCGCTTGGAGCGGATGTGCCCGGGAGTCGTGTCGTGCTCGGACATCCTCGCACTGGCTGCTCGAGACGCCGTTTGGATC
AGTGGAGGACCTCGCTGGAGTGTCCCGACGGGACGTCTG
GACGGGCGAGTCTCGCTGGCGACGGAAGCCGATAACGAGATTCCACCACCGGATCTCCGAATCCGGGACTTGAGAAAGGCATTTCTCGCCAAGGGCCTCAACACCCACGACGTCGTCACC
CTCTCAG
GCGCGCACACTATCGGTCGAGCACACTGCCCCGCCTTTGAGGACCGCCTCTACAACTTCTCCGCAACAAACGCGCCAGATCCCACCGTCAATCTGTCGCTGCTGGACTCGCTC
CAAAAGATTTGCCCCAGGGTTGGGAATACCACCTTCACGGTGAGCCTGGATCGCCAGACCCAAGTCCTGTTTGACAACAGCTACTACGTCCAGATCCTGGCCAGCAATGGGCTCCTCCAG
ACCGATCAGCAGCTCCTCTTCGACGCCTCCACCGCGGGGTTGGTGCGAGCGTACGCCGCCGATTCGTCCATGTTCTTCCGCGCCTTCGCCAAGGCCATGATCAAGCTCAGCAGGGTGGGT
TTGAAAGCTCCTGGCGAGGGCGAGATCCGGAAGCACTGCCGTCGTGTAAATCCATGA

Retrieve as FASTA