Entry information : SmPrx22-1_79 (SmPrx22a_79)
Entry ID 6994
Creation 2009-12-18 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: SmPrx22-1_79 (SmPrx22a_79)
Name (synonym) SmPrx22-1_79 (SmPrx22a_79)
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx22-1_79
start..stop
S start..stop
SmPrx22-2_67 682 0 1..341 1..338
SmPrx02-1_122 365 1.57e-126 20..340 6..327
SmPrx02-2_114 363 1.1e-125 20..340 6..327
SmPrx09-1_40 323 5.14e-110 24..341 9..330
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6994' 'complement(join(96873..97282,97364..97529,97600..97794,97848..97977,98434..98558))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 98434..98558 123 N° 2 97848..97977 128 N° 3 97600..97794 193 N° 4 97364..97529 164
N° 5 96873..97282 408  
complement(join(96873..97282,97364..97529,97600..97794,97848..97977,98434..98558 ))


exon

Literature and cross-references SmPrx22-1_79 (SmPrx22a_79)
DNA ref. Phytozome 12:   scaffold_79 (98558..96873)
mRNA ref. JGI transcript:   14540 [Incorrect prediction]
Protein sequence: SmPrx22-1_79 (SmPrx22a_79)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (330)
PWM (Da):   %s   37225 (35250.1)  
PI (pH):   %s   8.35 (8.92) Peptide Signal:   %s   cut: 25 range:25-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHLICGGGGGGGVYFHRSCALWLLVILLPQCWVAVSSQYEGEGFYDQSCPSAESVVRRTMVDSFRRNPLLAAGILRLFFHDCFVGCDGSVLLDRKPGGPIPEKESDVNNNSITGFRVIDDAKKRLERMCPGVVSCSDILALAARDAVWISGGPRWSVPTGR
LDGRVSLATEADNEIPPPDLRIRDLRKAFLAKGLNTHDVVTLS
GAHTIGRAHCPAFEDRLYNFSATNAPDPTLNLSLLDSLQKICPRVGNTTFTVSLDRQTQVLFDNSYYVQLLASNGLL
QTDQQLLFDASTAGLVRAYAADSSMFFRAFAKAMIKLSRVGLKAPGEGEIRKHCRRVNP

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns and extra 5' intron). No ESTs. Incorrect transcript prediction from JGI. Containing IntR (5').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTTGATCTGTGGTGGTGGTGGTGGTGGTGGTGTGTACTTCCATAGATCTTGCGCATTGTGGCTGCTCGTAATTCTCCTCCCGCAATGTTGGGTGGCGGTGTCTTCTCAATACGAA
GGAGA
GCAAGGAATGTTCTACTCCAACAATGATCAAGGTGGCCAAGAACAGGGAATGTTTTATGGTGATGATGATCAATCATGGTCCGGTGGTGCATTTCGAGGAGGAGCGTTTCGAGAC
GATCGTGAGCGGTACTGGCGGGAGTCAAATCCAGACCCGTATCCAGATCCAAACCCCTCGCAACTTCAGCAGCCCGATCAGGTTGTGTCTCAGCAACAGATTCCGAATCAACCTCCGCAA
CAGATTCCGCAGCAGGTGCAGAATCCGAACCAGTTTCCACAGCAGGTTCAGAACCAGAACCCAAATCAGCCGCAAGTTCAGAACCAGAACCAGAATCAACAACAAGTTCAGAACCAGAAC
CAGAATCAACAACAAGTTCAGAACCAGAACCAGAATCAACAACAAGTTCAGAACCAGAACCAGAATCAACAACAAGCTCAGAACCAGAACCAAGTGGTCAGAGAGGATTTTATGACCAGA
GCTGCCCTTCAGCGGAATCCGTCGTCCGGAGGACCATGGTGGACAGCTTCCGGCGGAACCCGCTGCTGGCCGCCGGAATCCTCCGGCTCTTCTTCCATGACTGCTTTGTCCGA
GTAAGTT
GGAGACTTTTGGAAAAGATTGATCGATCTGTAACTCGACAATGCAGGGGGTTGTGATGGATCGGTGCTGCTGGATCGAAAACCCGGCGGACCCATCCCTGAAAAGGAGAGCGACGTGAAC
AACAACTCCATCACTGGCTTCCGGGTGATTGACGACGCCAAGAAGCGCTTGGAGCGGATGTGCCCGGGAGTCGTGTCGTGCTCGGACATCCTCGCACTGGCTGCTCGAGACGCCGTTTGG
ATC
GTAAGTCCTGATAGAAAAGAAACTTTCCATCTCCTTTTAGTGACACGAAATGCCTTCCGGGTTAGAGCAGAGAGTGGAGGACCTCGCTGGAGTGTCCCGACGGGACGTCTGGACGGG
CGAGTCTCGCTGGCGACGGAAGCCGATAATGAGATTCCACCACCGGATCTCCGAATCCGGGACTTGAGAAAGGCATTTCTCGCCAAGGGCCTCAACACCCACGACGTCGTCACCCTCTCA
G
GCTAGTAAAACATTTCCTCTTTAATTATACAGCGTTTGCCTAGTTTCGGCATTTGCTAAAGATTGTAAAGTTCTTTCACAGGCGCGCGCACACTATCGGTCGAGCACACTGCCCCGCCT
TTGAGGACCGCCTCTACAACTTCTCCGCAACAAACGCGCCAGATCCCACGCTCAACCTCTCGCTGCTGGACTCGCTCCAAAAGATTTGCCCCAGGGTTGGGAATACCACCTTCACGGTGA
GCCTGGATCGCCAGACCCAGGTCCTGTTTGACAACAGCTACTACGTCCAGCTCCTGGCCAGCAATGGGCTCCTCCAGACCGATCAGCAGCTCCTCTTCGACGCCTCCACCGCGGGGTTGG
TGCGAGCGTACGCCGCCGATTCGTCCATGTTCTTCCGCGCCTTCGCCAAGGCCATGATCAAGCTCAGCAGGGTGGGTTTGAAAGCTCCTGGCGAGGGTGAGATCCGGAAGCACTGCCGTC
GTGTAAATCCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTTGATCTGTGGTGGTGGTGGTGGTGGTGGTGTGTACTTCCATAGATCTTGCGCATTGTGGCTGCTCGTAATTCTCCTCCCGCAATGTTGGGTGGCGGTGTCTTCTCAATACGAA
GGAGA
AGGATTTTATGACCAGAGCTGCCCTTCAGCGGAATCCGTCGTCCGGAGGACCATGGTGGACAGCTTCCGGCGGAACCCGCTGCTGGCCGCCGGAATCCTCCGGCTCTTCTTCCAT
GACTGCTTTGTCCGA
GGTTGTGATGGATCGGTGCTGCTGGATCGAAAACCCGGCGGACCCATCCCTGAAAAGGAGAGCGACGTGAACAACAACTCCATCACTGGCTTCCGGGTGATTGAC
GACGCCAAGAAGCGCTTGGAGCGGATGTGCCCGGGAGTCGTGTCGTGCTCGGACATCCTCGCACTGGCTGCTCGAGACGCCGTTTGGATC
AGTGGAGGACCTCGCTGGAGTGTCCCGACG
GGACGTCTGGACGGGCGAGTCTCGCTGGCGACGGAAGCCGATAATGAGATTCCACCACCGGATCTCCGAATCCGGGACTTGAGAAAGGCATTTCTCGCCAAGGGCCTCAACACCCACGAC
GTCGTCACCCTCTCAG
GCGCGCACACTATCGGTCGAGCACACTGCCCCGCCTTTGAGGACCGCCTCTACAACTTCTCCGCAACAAACGCGCCAGATCCCACGCTCAACCTCTCGCTGCTG
GACTCGCTCCAAAAGATTTGCCCCAGGGTTGGGAATACCACCTTCACGGTGAGCCTGGATCGCCAGACCCAGGTCCTGTTTGACAACAGCTACTACGTCCAGCTCCTGGCCAGCAATGGG
CTCCTCCAGACCGATCAGCAGCTCCTCTTCGACGCCTCCACCGCGGGGTTGGTGCGAGCGTACGCCGCCGATTCGTCCATGTTCTTCCGCGCCTTCGCCAAGGCCATGATCAAGCTCAGC
AGGGTGGGTTTGAAAGCTCCTGGCGAGGGTGAGATCCGGAAGCACTGCCGTCGTGTAAATCCATGA

Retrieve as FASTA