Entry information : SmPrx14-2_57 (SmPrx14b_57)
Entry ID 6997
Creation 2009-10-05 (Paula Nunes)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx14-2_57 (SmPrx14b_57)
Name (synonym) SmPrx14-2_57 (SmPrx14b_57)
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx14-2_57
start..stop
S start..stop
SmPrx13-2_57 685 0 1..332 1..332
SmPrx13-1_0 679 0 1..332 1..332
SmPrx14-1_0 677 0 1..332 1..332
SmPrx30-1_84 421 4.97e-149 7..332 10..331
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6997' 'complement(join(456826..457235,457315..457477,457536..457733,457788..458015))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 457788..458015 226 N° 2 457536..457733 196 N° 3 457315..457477 161 N° 4 456826..457235 408
complement(join(456826..457235,457315..457477,457536..457733,457788..458015))


exon

Literature and cross-references SmPrx14-2_57 (SmPrx14b_57)
DNA ref. Phytozome 12:   scaffold_57 (458015..456826)
mRNA ref. JGI transcript:   117818
Protein sequence: SmPrx14-2_57 (SmPrx14b_57)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (310)
PWM (Da):   %s   36434.27 (34082.9) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.04 (9.04) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METWRGSVLVLLLLSLSLGVLAHGESGGRKHGYHSYSRSCPQAER
IILDTLSKHAGWDRTIPAGVLRLHFHDCFVD
GCDGSILLDSTPTDGTKVEKLSLPNFMSARGFEMIEEAKQRLEAACPGVVSCADTLAIAARDSTVMLGGKYYQVPTGRYDGRVSSQERGNTLPSPFSDASALIQNFKERGLSVQDLVVLSGGHTLGTAGCATFSNRLNNFTKTGKPDPTINPRYLSHLRRQCPAPGSPNRVELDKGSEFVFDNSYYKNLARRNGVLTSDQVLNEDSRTSHYVKNFAHKQHNFLSQFAASMVKMGYIGWKN
KHNGEIRRVCSMVNTH

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTTGGAGAGGGAGCGTTTTGGTTTTGCTGCTGCTGTCACTGAGCTTGGGTGTCTTGGCTCACGGTGAGAGTGGAGGACGCAAGCATGGCTACCACAGCTACTCGAGATCTTGT
CCTCAGGCCGAGAGGATCATACTGGACACTCTAAGCAAGCACGCCGGTTGGGACAGGACGATACCAGCAGGAGTTCTTCGCTTGCACTTCCACGACTGTTTCGTAGAC
GTGAGTAGCTTC
ACAAGATTTAGATTCTGGTTTTCTAACTTTGCTGTTCTCCAGGGGGCTGTGATGGATCGATTCTTCTGGACTCAACTCCCACCGACGGAACTAAAGTGGAAAAATTGTCCCTTCCAAACT
TCATGTCCGCCAGGGGCTTCGAGATGATTGAGGAAGCAAAGCAGAGGTTGGAAGCAGCTTGTCCTGGAGTTGTCTCCTGTGCTGACACTCTCGCCATAGCTGCCAGAGATTCGACCGTCA
TG
GTAAGCTTAGCATCTTTTTAGAAACGCTGAATCAAGTTCTAAGACGTTGTCACTGCAGCTCTTGGAGGAAAGTATTACCAAGTCCCAACCGGACGCTACGACGGAAGAGTTTCCAGCC
AGGAACGTGGCAACACTTTACCATCCCCGTTTAGCGATGCGTCGGCTCTCATTCAAAACTTCAAGGAGCGCGGCTTGTCAGTCCAGGACCTCGTCGTTCTCTCAG
GTACGAATCGATTTC
AACTTCCATCTCTTTCCATCCAGTTTGTAAGTAGGCATTAACGCTACTCCCTTGCAAACCACAGGTGTGGTCACACTCTTGGTACCGCCGGCTGCGCCACATTCAGCAATCGTTTGAACA
ACTTTACGAAAACTGGCAAGCCGGACCCGACCATCAATCCCAGATACCTCTCTCATCTCCGGAGGCAGTGCCCAGCACCGGGGTCGCCAAACCGTGTGGAGCTGGACAAAGGCTCGGAGT
TTGTGTTCGACAACAGCTACTACAAGAACTTGGCCAGGAGAAACGGGGTCCTCACGTCGGATCAAGTTCTCAACGAGGACTCGAGAACAAGCCACTACGTCAAGAACTTTGCGCACAAGC
AGCACAACTTTCTGTCGCAGTTTGCGGCCTCGATGGTGAAGATGGGATACATTGGGTGGAAGAACAAGCACAATGGGGAAATCAGAAGGGTGTGCTCCATGGTAAACACCCATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTTGGAGAGGGAGCGTTTTGGTTTTGCTGCTGCTGTCACTGAGCTTGGGTGTCTTGGCTCACGGTGAGAGTGGAGGACGCAAGCATGGCTACCACAGCTACTCGAGATCTTGT
CCTCAGGCCGAGAGGATCATACTGGACACTCTAAGCAAGCACGCCGGTTGGGACAGGACGATACCAGCAGGAGTTCTTCGCTTGCACTTCCACGACTGTTTCGTAGAC
GGCTGTGATGGA
TCGATTCTTCTGGACTCAACTCCCACCGACGGAACTAAAGTGGAAAAATTGTCCCTTCCAAACTTCATGTCCGCCAGGGGCTTCGAGATGATTGAGGAAGCAAAGCAGAGGTTGGAAGCA
GCTTGTCCTGGAGTTGTCTCCTGTGCTGACACTCTCGCCATAGCTGCCAGAGATTCGACCGTCATG
CTTGGAGGAAAGTATTACCAAGTCCCAACCGGACGCTACGACGGAAGAGTTTCC
AGCCAGGAACGTGGCAACACTTTACCATCCCCGTTTAGCGATGCGTCGGCTCTCATTCAAAACTTCAAGGAGCGCGGCTTGTCAGTCCAGGACCTCGTCGTTCTCTCAG
GTGGTCACACT
CTTGGTACCGCCGGCTGCGCCACATTCAGCAATCGTTTGAACAACTTTACGAAAACTGGCAAGCCGGACCCGACCATCAATCCCAGATACCTCTCTCATCTCCGGAGGCAGTGCCCAGCA
CCGGGGTCGCCAAACCGTGTGGAGCTGGACAAAGGCTCGGAGTTTGTGTTCGACAACAGCTACTACAAGAACTTGGCCAGGAGAAACGGGGTCCTCACGTCGGATCAAGTTCTCAACGAG
GACTCGAGAACAAGCCACTACGTCAAGAACTTTGCGCACAAGCAGCACAACTTTCTGTCGCAGTTTGCGGCCTCGATGGTGAAGATGGGATACATTGGGTGGAAGAACAAGCACAATGGG
GAAATCAGAAGGGTGTGCTCCATGGTAAACACCCATTAA

Retrieve as FASTA