Entry information : SmPrx07-2_11 (SmPrx07b_11)
Entry ID 6999
Creation 2009-10-02 (Christophe Dunand)
Last sequence changes 2009-10-02 (Christophe Dunand)
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx07-2_11 (SmPrx07b_11)
Name (synonym) SmPrx07-2_11 (SmPrx07b_11)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx07-2_11
start..stop
S start..stop
SmPrx07-1_23 627 0 1..320 1..320
PtaPrx14 409 2e-144 4..320 5..328
PabPrx235 405 7e-143 21..320 25..328
PabPrx50 400 9e-141 21..320 25..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1787165..1787368 204 N° 2 1787448..1787639 192 N° 3 1787719..1788285 567  
join(1787165..1787368,1787448..1787639,1787719..1788285)


exon

Literature and cross-references SmPrx07-2_11 (SmPrx07b_11)
DNA ref. Phytozome 12:   scaffold_11 (1787165..1788285)
EST ref. GenBank:   FE462458.1 [5' end]   FE482980.1 [3' end]
Protein sequence: SmPrx07-2_11 (SmPrx07b_11)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (299)
PWM (Da):   %s   34031.7 (31727.4)  
PI (pH):   %s   4.94 (4.72) Peptide Signal:   %s   cut: 22 range:22-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGYEVLATVLLTILFRRSVAQLSPSFYNSSCPTVETVVTNTLQQAMQSDVRIAASLLRVHFHDCFVNGCDASVLLDDTANFTGEKTAAPNNASLRGFDVIDQMKSQVDSVCNNTVSCADILAIAAKAAVVLSGGPSWTVQLGRRDSTTANFSLAQANIPPPTSTNAQLIAAYQNVGLSTQDMVVLSGAHTFGRARCTTFSNRLFNFTNGQPDPRINTAYLATLQQICPNGGNGSVVANFDPVTQDTFDNQYYANVLNGQGLLNSDAELLNGTTAALVSNFSTDQTSFFNNFAVSMVNMGNLQPLTGSQGEIRSNCRKTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns) and 4 ESTs (FE462457.1, FE482981.1). No prediction from JGI. Contigs also contains SmPrx05b and SmPrx06b
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGCTACGAAGTACTTGCAACGGTGCTGCTTACAATCCTTTTCCGGCGATCCGTCGCTCAGCTCAGTCCCTCTTTCTACAACTCGTCTTGCCCCACCGTAGAGACCGTCGTGACA
AATACTCTCCAGCAGGCAATGCAGAGCGATGTTCGAATTGCTGCCTCGCTTCTCCGGGTGCATTTCCACGACTGCTTCGTAAAT
GTAAGTATTGAATTTAATTTCTCTCCTTTTGTTCCA
GAATTCCTCTGTCTCCTTCTGACTCGTCCTCTGCCTCCCGCAGGGCTGCGACGCGTCAGTTCTCCTGGACGACACTGCGAATTTCACAGGAGAGAAAACGGCAGCTCCAAACAACGCCTC
GCTCCGAGGCTTCGATGTCATCGACCAGATGAAGTCGCAGGTTGACAGCGTCTGCAACAACACCGTCTCCTGTGCCGACATCCTCGCCATCGCAGCCAAGGCGGCAGTAGTCCTG
GTCAG
TACTCTAACCCGAATCCATTTCGCGAAATCACAAACTCTTAACCCCCGCACCTTCTCTTCTTTCTTTTTCCCAGAGCGGAGGACCATCCTGGACGGTCCAGCTGGGAAGGCGAGACAGCA
CCACAGCAAACTTCTCCCTCGCGCAGGCCAACATCCCGCCGCCAACATCCACGAACGCTCAGCTCATTGCGGCGTACCAGAATGTGGGGCTCTCGACGCAGGACATGGTGGTCTTGTCCG
GCGCGCACACCTTCGGCCGGGCTCGCTGCACCACTTTCTCCAACAGGCTCTTCAACTTCACCAACGGGCAGCCCGATCCCCGGATCAACACAGCGTACCTGGCGACCCTCCAGCAGATCT
GTCCCAACGGGGGCAACGGCAGCGTAGTGGCCAACTTCGACCCCGTCACCCAGGACACTTTCGACAACCAGTACTACGCCAATGTGCTCAATGGCCAGGGCCTGCTCAACTCGGACGCCG
AGCTCCTCAACGGCACCACCGCGGCGCTTGTCAGCAACTTCAGCACCGATCAGACGAGCTTCTTCAACAATTTCGCGGTGTCCATGGTGAACATGGGGAATTTGCAGCCGCTCACCGGCA
GCCAGGGCGAGATCCGGAGCAACTGCAGGAAAACCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGCTACGAAGTACTTGCAACGGTGCTGCTTACAATCCTTTTCCGGCGATCCGTCGCTCAGCTCAGTCCCTCTTTCTACAACTCGTCTTGCCCCACCGTAGAGACCGTCGTGACA
AATACTCTCCAGCAGGCAATGCAGAGCGATGTTCGAATTGCTGCCTCGCTTCTCCGGGTGCATTTCCACGACTGCTTCGTAAAT
GGCTGCGACGCGTCAGTTCTCCTGGACGACACTGCG
AATTTCACAGGAGAGAAAACGGCAGCTCCAAACAACGCCTCGCTCCGAGGCTTCGATGTCATCGACCAGATGAAGTCGCAGGTTGACAGCGTCTGCAACAACACCGTCTCCTGTGCCGAC
ATCCTCGCCATCGCAGCCAAGGCGGCAGTAGTCCTG
AGCGGAGGACCATCCTGGACGGTCCAGCTGGGAAGGCGAGACAGCACCACAGCAAACTTCTCCCTCGCGCAGGCCAACATCCCG
CCGCCAACATCCACGAACGCTCAGCTCATTGCGGCGTACCAGAATGTGGGGCTCTCGACGCAGGACATGGTGGTCTTGTCCGGCGCGCACACCTTCGGCCGGGCTCGCTGCACCACTTTC
TCCAACAGGCTCTTCAACTTCACCAACGGGCAGCCCGATCCCCGGATCAACACAGCGTACCTGGCGACCCTCCAGCAGATCTGTCCCAACGGGGGCAACGGCAGCGTAGTGGCCAACTTC
GACCCCGTCACCCAGGACACTTTCGACAACCAGTACTACGCCAATGTGCTCAATGGCCAGGGCCTGCTCAACTCGGACGCCGAGCTCCTCAACGGCACCACCGCGGCGCTTGTCAGCAAC
TTCAGCACCGATCAGACGAGCTTCTTCAACAATTTCGCGGTGTCCATGGTGAACATGGGGAATTTGCAGCCGCTCACCGGCAGCCAGGGCGAGATCCGGAGCAACTGCAGGAAAACCAAC
TGA

Retrieve as FASTA