Entry information : SmPrx08-2_107 (SmPrx08b_107)
Entry ID 7000
Creation 2009-10-02 (Paula Nunes)
Last sequence changes 2009-10-02 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx08-2_107 (SmPrx08b_107)
Name (synonym) SmPrx08-2_107 (SmPrx08b_107)
Class Class III peroxidase    [Orthogroup: Prx076]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx08-2_107
start..stop
S start..stop
SmPrx08-1_40 659 0 1..326 1..328
CmichPrx06 394 3e-138 6..326 7..329
ApuncPrx04 385 2e-134 29..326 70..371
GbPrx24 384 2e-134 27..326 28..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 529283..529501 219 N° 2 528992..529180 189 N° 3 528550..528715 166 N° 4 527662..528068 407
complement(join(527662..528068,528550..528715,528992..529180,529283..529501))


exon

Literature and cross-references SmPrx08-2_107 (SmPrx08b_107)
DNA ref. Phytozome 12:   scaffold_107 (529501..527662)
mRNA ref. JGI transcript:   131487
Protein sequence: SmPrx08-2_107 (SmPrx08b_107)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (299)
PWM (Da):   %s   35154.96 (32309.3)  
PI (pH):   %s   8.21 (7.72) Peptide Signal:   %s   cut: 28 range:28-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSIGAALAKIWLVIALGASIWPVSRQQQLDSNLYRSRCPALEPISATAVARQIRKDPTSAAPLVRMFFHDCFGCDASVLLDSTKNSTAEKEATPNVSLRQFDVLEEIKTQVEAKCPGVVSCADIVALAARDATVQTGGPSWNVEFGRRDGRSSSDAMAAAHLPSSRSSAQPLIDSFAAVGLSIRDLVTLSGAHTFGRAHCTQVARRFYAFNNASGIDPTLDSSYAQRLRRLCPQPLDAHGMVDLDPITPNVFDTLYYQGLLMNLGIFSSDSALVLDNRTKVFVQEYAVNPVSFVQQFPGAMVRLGRIGVLTGSQGEIRKRCNVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTATCGATCGGAGCGGCATTGGCGAAGATTTGGCTGGTAATCGCGCTGGGAGCGTCGATCTGGCCAGTGTCCCGGCAGCAGCAGCTGGATTCCAATTTATATCGCTCGCGATGCCCC
GCGCTGGAGCCGATCTCCGCCACGGCCGTGGCGCGGCAGATTAGGAAGGATCCGACCTCCGCCGCGCCGCTCGTCCGGATGTTCTTCCACGATTGCTTC
GTCCAGGCAAGGCGCACTCGT
ATTTCGATCGATCGATCGATCGATCGGCGAAATATTTTGGTCTGACATGTTTTGCGCGTGTTCTTGTTTCTTTCTTGACAGGGTTGCGATGCGTCAGTGCTACTAGATTCGACCAAGAAC
AGCACGGCCGAGAAGGAGGCAACGCCAAACGTATCGCTGCGCCAATTCGATGTCCTGGAGGAGATCAAGACGCAGGTGGAGGCCAAATGTCCGGGAGTGGTTTCTTGCGCCGACATTGTG
GCGCTGGCCGCTAGAGATGCCACAGTCCAG
GTACACGAATCGATTCTAGCTCATCGATCGAAATTCGCGAAGATTTCCCTCTTCTTGTTCTTGGTTCTCTTTCTCTCTCTTGCTCGAAAT
CTCACGCTCGGGAAAAGGGAAAGGATGATTCCGTCGTGCTTCTCGTGATGCCGGCCAAATTCATCTCTCACGCGCTCGATTTCTTGGAAAGATCGTTCCATTCCTTGCCTGCATTGATTG
ATTGTCATGAGCATCGGCATCGCAGCTTTAAAAATTCACTCTTCTTCCTCGTTTGCTCCTTGGCAGACTGGAGGACCGAGCTGGAACGTGGAATTCGGGCGGAGGGATGGGCGGAGCTCG
TCCGATGCGATGGCTGCCGCGCATTTGCCGTCGTCGCGATCCAGCGCTCAGCCTCTCATCGACAGCTTCGCGGCGGTGGGGCTGTCAATCCGGGATCTGGTGACTCTATCAG
GTACTCTG
CTCTTCCCCTGGCTCGTGATGTCATACTCCATGTCATAGCCCTGGCTTTTACCCTGGGTTTTGGTTCCCGTCATGTCATAGCTCCTGGTTTTTTGATCCCCGAACATGTCATAAGCCCCC
AGGTTCTAGTCCACGTGTTCTTAAAGTTGCTGTGCCCGAATCCTTTGTCCTGTCTTCTTCACTGCAATGCCTGACTGAATTCTCGCTGTCACTAGTTTACCACTGTCATCCACTGGAAGA
CATTGGAGAGTTCTGTATGAAGTAAATGTTTGTTTCTTATCCCTTCGCCACTCATTGTTCTACTCGATTTGACTGGCATTTGTTCTGGAGCTCTGGAGCTCTGCGTAGCGTAGGATCTTC
TTTGGACTAGACAATCCAAGTTGCGTGACTTGATCGACTTGATCGATCGATCGAACGCGCTCCTGGAATGGTTTTTTATTCTCGTCCTTTCTCATACTTTCTCTCTTTTGCAGGAGCTCA
TACTTTTGGACGAGCGCACTGCACCCAAGTGGCGCGTCGCTTCTATGCTTTCAACAACGCCAGCGGCATCGATCCCACGCTCGATTCCAGCTACGCGCAGCGGCTCCGGCGGCTGTGCCC
GCAGCCGTTGGATGCCCACGGAATGGTCGACCTGGATCCAATCACGCCCAACGTCTTCGACACGCTCTACTACCAGGGACTGCTCATGAACCTGGGGATATTCTCCTCCGATTCCGCGCT
CGTTCTGGACAACCGGACGAAGGTGTTCGTGCAGGAATATGCGGTCAACCCAGTCTCGTTCGTTCAACAGTTTCCGGGCGCCATGGTCAGACTTGGTCGCATTGGTGTGTTGACCGGCAG
TCAAGGTGAGATTAGAAAAAGATGTAACGTGGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTATCGATCGGAGCGGCATTGGCGAAGATTTGGCTGGTAATCGCGCTGGGAGCGTCGATCTGGCCAGTGTCCCGGCAGCAGCAGCTGGATTCCAATTTATATCGCTCGCGATGCCCC
GCGCTGGAGCCGATCTCCGCCACGGCCGTGGCGCGGCAGATTAGGAAGGATCCGACCTCCGCCGCGCCGCTCGTCCGGATGTTCTTCCACGATTGCTTC
GGTTGCGATGCGTCAGTGCTA
CTAGATTCGACCAAGAACAGCACGGCCGAGAAGGAGGCAACGCCAAACGTATCGCTGCGCCAATTCGATGTCCTGGAGGAGATCAAGACGCAGGTGGAGGCCAAATGTCCGGGAGTGGTT
TCTTGCGCCGACATTGTGGCGCTGGCCGCTAGAGATGCCACAGTCCAG
ACTGGAGGACCGAGCTGGAACGTGGAATTCGGGCGGAGGGATGGGCGGAGCTCGTCCGATGCGATGGCTGCC
GCGCATTTGCCGTCGTCGCGATCCAGCGCTCAGCCTCTCATCGACAGCTTCGCGGCGGTGGGGCTGTCAATCCGGGATCTGGTGACTCTATCAG
GAGCTCATACTTTTGGACGAGCGCAC
TGCACCCAAGTGGCGCGTCGCTTCTATGCTTTCAACAACGCCAGCGGCATCGATCCCACGCTCGATTCCAGCTACGCGCAGCGGCTCCGGCGGCTGTGCCCGCAGCCGTTGGATGCCCAC
GGAATGGTCGACCTGGATCCAATCACGCCCAACGTCTTCGACACGCTCTACTACCAGGGACTGCTCATGAACCTGGGGATATTCTCCTCCGATTCCGCGCTCGTTCTGGACAACCGGACG
AAGGTGTTCGTGCAGGAATATGCGGTCAACCCAGTCTCGTTCGTTCAACAGTTTCCGGGCGCCATGGTCAGACTTGGTCGCATTGGTGTGTTGACCGGCAGTCAAGGTGAGATTAGAAAA
AGATGTAACGTGGTCAACTGA

Retrieve as FASTA