Entry information : SmPrx07-1_23 (SmPrx07a_23)
Entry ID 7002
Creation 2009-10-02 (Christophe Dunand)
Last sequence changes 2009-10-02 (Christophe Dunand)
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx07-1_23 (SmPrx07a_23)
Name (synonym) SmPrx07-1_23 (SmPrx07a_23)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx07-1_23
start..stop
S start..stop
SmPrx07-2_11 627 0 1..320 1..320
PtaPrx14 408 4.76e-144 3..320 4..328
PabPrx235 402 1.15e-141 21..320 25..328
PtaPrx62 396 2.1e-139 19..320 23..328
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7002' 'complement(join(1957555..1958121,1958201..1958392,1958472..1958675))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1958472..1958675 202 N° 2 1958201..1958392 190 N° 3 1957555..1958121 565  
complement(join(1957555..1958121,1958201..1958392,1958472..1958675))


exon

Literature and cross-references SmPrx07-1_23 (SmPrx07a_23)
DNA ref. Phytozome 12:   scaffold_23 (1958675..1957555)
Protein sequence: SmPrx07-1_23 (SmPrx07a_23)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (299)
PWM (Da):   %s   34229.84 (31812.5)  
PI (pH):   %s   5.22 (4.72) Peptide Signal:   %s   cut: 22 range:22-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARYEVLATLLLTILFRRSVAQLSPSFYNSSCPTVETVVTNTLQQ
AMQSDVRIAASLLRMHFHDCFVN
GCDASSLLDDTANFTGEKTAAPNNASLRGFDVIDQIKSQVDSVCNNTVSCADILAIAAKAAVVLSGGPSWTVQLGRRDSTTANFSLAQANIPPPTSTNAQLIAAYQNVGLSTLDMVVLSG
AHTFGRARCTTFSNRLFNFSNGQPDPRINSTYLPTLQQICPNGGNGSVVANFDPVTQDTFDNQYYANVLNGQVLLNSDAELLNGTTAALVSNFSTDQTSFFNNFAVSMVNMGNLQPLTGS
QGEIRSNCRRTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No prediction from JGI.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGCTACGAAGTACTTGCAACGTTGCTGCTTACAATCCTTTTCCGGCGATCCGTCGCTCAGCTCAGTCCCTCTTTCTACAACTCGTCTTGCCCCACCGTAGAGACCGTCGTGACA
AATACTCTCCAGCAGGCAATGCAGAGCGATGTTCGAATTGCTGCCTCGCTTCTCCGGATGCATTTCCACGACTGCTTCGTAAAT
GTAAGTATTGAATTTAATTTCTCTCCTTTTGGTCCA
GAATTCCTCTGTCTCCTTCTGACTCGTCCTCTGCCCCCCGCAGGGGGCTGCGATGCGTCATCTCTCCTGGACGACACTGCGAATTTCACAGGGGAGAAAACGGCAGCTCCAAACAACGCC
TCGCTCCGAGGCTTCGATGTCATCGACCAGATTAAGTCGCAGGTTGACAGCGTCTGCAACAACACCGTCTCCTGTGCCGACATCCTCGCCATCGCAGCCAAGGCGGCAGTAGTCCTG
GTC
AGTACTCTAACCCGAATCCATTTCACGAAATCACAAACTCTTAACCCCCGCACCTTCTCTTCTTTCTTTTTCCCAGAGAGCGGAGGACCATCCTGGACGGTCCAGCTGGGAAGGCGAGAC
AGCACCACAGCAAACTTCTCCCTCGCGCAGGCCAACATCCCGCCGCCAACATCCACGAACGCTCAGCTCATTGCGGCGTACCAGAATGTGGGGCTCTCGACGCTGGACATGGTGGTCTTG
TCCGGCGCGCACACCTTCGGCCGGGCTCGCTGCACCACTTTCTCCAACAGGCTCTTCAACTTCAGCAACGGGCAGCCCGATCCCCGGATCAACTCAACGTACCTGCCGACCCTCCAGCAG
ATCTGTCCCAACGGGGGCAACGGCAGCGTGGTGGCCAACTTCGACCCCGTCACCCAGGACACTTTCGACAACCAGTACTACGCCAATGTGCTCAATGGCCAGGTCCTGCTCAACTCGGAC
GCCGAGCTCCTCAACGGCACCACCGCGGCGCTTGTCAGCAACTTCAGCACCGATCAGACGAGCTTCTTCAACAATTTCGCGGTGTCCATGGTGAACATGGGGAATTTGCAGCCGCTCACC
GGCAGCCAGGGCGAGATCCGGAGCAACTGCAGGAGAACCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGCTACGAAGTACTTGCAACGTTGCTGCTTACAATCCTTTTCCGGCGATCCGTCGCTCAGCTCAGTCCCTCTTTCTACAACTCGTCTTGCCCCACCGTAGAGACCGTCGTGACA
AATACTCTCCAGCAGGCAATGCAGAGCGATGTTCGAATTGCTGCCTCGCTTCTCCGGATGCATTTCCACGACTGCTTCGTAAAT
GGCTGCGATGCGTCATCTCTCCTGGACGACACTGCG
AATTTCACAGGGGAGAAAACGGCAGCTCCAAACAACGCCTCGCTCCGAGGCTTCGATGTCATCGACCAGATTAAGTCGCAGGTTGACAGCGTCTGCAACAACACCGTCTCCTGTGCCGAC
ATCCTCGCCATCGCAGCCAAGGCGGCAGTAGTCCTG
AGCGGAGGACCATCCTGGACGGTCCAGCTGGGAAGGCGAGACAGCACCACAGCAAACTTCTCCCTCGCGCAGGCCAACATCCCG
CCGCCAACATCCACGAACGCTCAGCTCATTGCGGCGTACCAGAATGTGGGGCTCTCGACGCTGGACATGGTGGTCTTGTCCGGCGCGCACACCTTCGGCCGGGCTCGCTGCACCACTTTC
TCCAACAGGCTCTTCAACTTCAGCAACGGGCAGCCCGATCCCCGGATCAACTCAACGTACCTGCCGACCCTCCAGCAGATCTGTCCCAACGGGGGCAACGGCAGCGTGGTGGCCAACTTC
GACCCCGTCACCCAGGACACTTTCGACAACCAGTACTACGCCAATGTGCTCAATGGCCAGGTCCTGCTCAACTCGGACGCCGAGCTCCTCAACGGCACCACCGCGGCGCTTGTCAGCAAC
TTCAGCACCGATCAGACGAGCTTCTTCAACAATTTCGCGGTGTCCATGGTGAACATGGGGAATTTGCAGCCGCTCACCGGCAGCCAGGGCGAGATCCGGAGCAACTGCAGGAGAACCAAC
TGA

Retrieve as FASTA