Entry information : SmPrx20-1_79 (SmPrx20a_79)
Entry ID 7005
Creation 2009-10-07 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx20-1_79 (SmPrx20a_79)
Name (synonym) SmPrx20-1_79 (SmPrx20a_79)
Class Class III peroxidase    [Orthogroup: Prx278]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx20-1_79
start..stop
S start..stop
SmPrx20-2_67 650 0 1..324 1..325
SmPrx80-2_66 330 2e-113 10..322 11..321
SmPrx80-1_13 327 4e-112 10..322 17..327
CclPrx43 300 1e-101 1..322 4..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 70180..70377 198 N° 2 69935..70129 195 N° 3 69714..69879 166 N° 4 69243..69658 416
complement(join(69243..69658,69714..69879,69935..70129,70180..70377))


exon

Literature and cross-references SmPrx20-1_79 (SmPrx20a_79)
DNA ref. Phytozome 12:   scaffold_79 (70377..69243)
mRNA ref. JGI transcript:   125521 [Incorrect splicing]
Protein sequence: SmPrx20-1_79 (SmPrx20a_79)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (305)
PWM (Da):   %s   35115.82 (33062.7)  
PI (pH):   %s   6.62 (6.24) Peptide Signal:   %s   cut: 20 range:20-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRFLAVLIAIAVIFPSSSHQFWPGFYDSSCPGIASIVAQVSLRRFQQLTNHPAQVLRLFFHDCFVEGCDGSILIGQTPQSSVERDSVANRDLVQDAFDTIDLAKQAVEAQCPGVVSCADILAMVTRDMLILAGGPGWNLALGRRDGTVSRADSALREIPSPRSGLDELLKNFHSKGLNLLDLVTLSGAHTLGVSHCSQFSQRLYGVNTSLDGTDPSLDPSFAKELKKDCPPGAPVTAIEFFDKAAPFTFDNHYFKNLEAGRSLLTSDESLLASFPSREIVRLFARDPALFFFSFAASMDKLSRLGVKTGGAGEIRRSCNRFNAQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect transcript prediction from JGI (splicing intron 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATTTCTGGCTGTTTTGATTGCAATCGCAGTGATTTTTCCAAGCTCTTCCCACCAATTCTGGCCCGGTTTCTACGACTCGAGCTGCCCAGGCATCGCATCCATCGTCGCGCAAGTT
TCACTGAGGAGATTCCAGCAGCTGACCAATCACCCAGCACAAGTTCTTCGGCTTTTCTTCCACGACTGCTTCGTAGAG
GTTTGTGTTGATCGGGTAGAGCGCGTTTGCCAATCCCACAAA
CAATGCAGGGCTGCGATGGATCGATCCTCATCGGCCAAACTCCGCAGTCCTCGGTCGAGAGAGACTCCGTGGCAAACCGGGACTTAGTCCAGGATGCGTTTGATACGATCGATCTCGCGA
AGCAAGCCGTGGAAGCCCAGTGCCCGGGTGTGGTCTCGTGTGCTGATATACTTGCGATGGTCACTCGAGATATGTTGATCCTG
GCAAGTTTCCAGCATGCTTCTGTGTCCTTGTTTTGAT
CTTTATAAACTCTTCCAGGCGGGAGGGCCGGGCTGGAATCTGGCGCTCGGACGGAGGGATGGAACAGTGTCACGCGCGGATAGCGCGCTTAGAGAAATCCCATCGCCAAGGTCTGGTCTG
GACGAGCTGCTCAAGAACTTCCACAGCAAAGGACTCAACTTACTTGATCTCGTCACGCTCTCTG
GTATGGATATGTAGCTGCTAGCTCGAAAAGCCTCGATGATCTTCTCTTTTTCCAGG
CGCTCACACGCTCGGGGTCTCCCACTGCTCGCAATTCAGCCAGAGGCTCTATGGAGTCAACACCTCTCTGGACGGCACAGACCCTTCTCTCGATCCGTCCTTCGCGAAGGAACTCAAGAA
GGACTGCCCGCCAGGAGCCCCTGTGACGGCCATCGAGTTCTTCGACAAGGCCGCGCCTTTCACCTTCGACAACCATTACTTCAAGAACCTGGAAGCCGGCAGATCGCTGCTCACATCCGA
CGAGAGCCTCCTCGCCTCCTTCCCCTCCAGGGAAATCGTCAGGCTATTCGCTCGAGATCCAGCGCTGTTCTTCTTTTCCTTCGCGGCATCCATGGACAAGCTCTCCAGATTGGGCGTCAA
GACCGGCGGGGCGGGCGAGATCCGGCGATCGTGTAACCGATTCAATGCGCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATTTCTGGCTGTTTTGATTGCAATCGCAGTGATTTTTCCAAGCTCTTCCCACCAATTCTGGCCCGGTTTCTACGACTCGAGCTGCCCAGGCATCGCATCCATCGTCGCGCAAGTT
TCACTGAGGAGATTCCAGCAGCTGACCAATCACCCAGCACAAGTTCTTCGGCTTTTCTTCCACGACTGCTTCGTAGAG
GGCTGCGATGGATCGATCCTCATCGGCCAAACTCCGCAGTCC
TCGGTCGAGAGAGACTCCGTGGCAAACCGGGACTTAGTCCAGGATGCGTTTGATACGATCGATCTCGCGAAGCAAGCCGTGGAAGCCCAGTGCCCGGGTGTGGTCTCGTGTGCTGATATA
CTTGCGATGGTCACTCGAGATATGTTGATCCTG
GCGGGAGGGCCGGGCTGGAATCTGGCGCTCGGACGGAGGGATGGAACAGTGTCACGCGCGGATAGCGCGCTTAGAGAAATCCCATCG
CCAAGGTCTGGTCTGGACGAGCTGCTCAAGAACTTCCACAGCAAAGGACTCAACTTACTTGATCTCGTCACGCTCTCTG
GCGCTCACACGCTCGGGGTCTCCCACTGCTCGCAATTCAGC
CAGAGGCTCTATGGAGTCAACACCTCTCTGGACGGCACAGACCCTTCTCTCGATCCGTCCTTCGCGAAGGAACTCAAGAAGGACTGCCCGCCAGGAGCCCCTGTGACGGCCATCGAGTTC
TTCGACAAGGCCGCGCCTTTCACCTTCGACAACCATTACTTCAAGAACCTGGAAGCCGGCAGATCGCTGCTCACATCCGACGAGAGCCTCCTCGCCTCCTTCCCCTCCAGGGAAATCGTC
AGGCTATTCGCTCGAGATCCAGCGCTGTTCTTCTTTTCCTTCGCGGCATCCATGGACAAGCTCTCCAGATTGGGCGTCAAGACCGGCGGGGCGGGCGAGATCCGGCGATCGTGTAACCGA
TTCAATGCGCAGTAG

Retrieve as FASTA