Entry information : SmPrx21-1_79 (SmPrx21a_79)
Entry ID 7006
Creation 2009-12-02 (Christophe Dunand)
Last sequence changes 2009-12-02 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: SmPrx21-1_79 (SmPrx21a_79)
Name (synonym) SmPrx21-1_79 (SmPrx21a_79)
Class Class III peroxidase    [Orthogroup: Prx086]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx21-1_79
start..stop
S start..stop
SmPrx21-2_30 672 0 1..328 1..328
GbPrx05 415 1.57e-146 10..327 17..336
CmichPrx14 410 1.75e-144 25..327 40..343
PabPrx86 407 2.29e-143 7..328 4..327
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7006' 'complement(join(690487..690896,690947..691112,691224..691418,691489..691704))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 691489..691704 214 N° 2 691224..691418 193 N° 3 690947..691112 164 N° 4 690487..690896 408
complement(join(690487..690896,690947..691112,691224..691418,691489..691704))


exon

Literature and cross-references SmPrx21-1_79 (SmPrx21a_79)
DNA ref. Phytozome 12:   scaffold_79 (691704..690487)
Protein sequence: SmPrx21-1_79 (SmPrx21a_79)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (303)
PWM (Da):   %s   34952.67 (32393.2)  
PI (pH):   %s   7.38 (7.36) Peptide Signal:   %s   cut: 26 range:26-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLVPVQASCLVALLLLLLFGSGIHAQLSPGYYSSSCPNVESIIQQ
VMLQKFKITPNSVPGTLRLFFHDCFVD
GCDASVLIASTASNSAEKDSEINLSLAGDGFDSVIKAKAAVEEKCPGIVSCADILAIATRDLVVLAGGPSWTVRKGRKDGKISQASRVDGNLPKPEQSVDQLTKLFASKGLSQTDMVALSGAHTIGFAHCKEFMSRIYNFNSTHQFDPAMDPNFAKDLRLTCPQSVDPRVVANNDVTTPAKFDNVYYQNAVRGVTVLASDQILHSDARTRGLVTAYAGQQGAFFAAFATAMDNLGAVGVK
TGNQGEIRKDCSRFNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Incorrect transcript prediction from JGI (little splicing error for the intron 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAGTACCAGTCCAGGCCTCTTGTCTTGTTGCTTTGCTGCTGCTACTCCTCTTTGGATCCGGCATTCATGCCCAGCTCTCTCCAGGCTACTACAGCAGCTCCTGCCCCAATGTGGAG
TCTATCATCCAGCAAGTGATGCTCCAGAAATTCAAGATCACACCCAACAGCGTCCCTGGCACGCTGCGGCTCTTCTTCCACGACTGCTTTGTCGAT
GTAAGTCCAATCTCCCTGTAAGTT
CTATCCCCTTCAAAAGTCTGAGTTTTCGAATGGAATTCGGCCGCAGGGGGATGCGATGCCTCGGTGCTCATCGCTTCCACGGCCAGCAACAGCGCAGAGAAGGATTCCGAGATCAACTTG
TCGCTGGCAGGCGATGGCTTCGACTCGGTCATCAAAGCCAAAGCTGCTGTTGAGGAGAAGTGCCCCGGGATCGTCTCTTGCGCGGACATTCTCGCCATTGCGACCAGGGACCTCGTTGTG
CTG
GCGAGTGATTCTCCTCCATCTTATCTTCGTGTCCAAGGAAAAAAAATTCCTTTTTTTCTCTTGGTCTTTGTTCTCCGAATTTTTTTCTTGCATTGATTGTCGGGATGGCAGGCGCAG
GAGGACCATCTTGGACAGTGAGGAAAGGCCGCAAAGATGGAAAGATCTCGCAAGCTTCAAGAGTCGACGGTAACTTGCCAAAGCCCGAGCAATCGGTCGACCAGCTCACCAAGCTCTTCG
CTTCCAAAGGACTCTCTCAAACGGACATGGTGGCTCTCTCAG
GTGAACTCCCTTCTCCTTCCTCTATCAAACTCACCAAAGAAATCTCTCAGGAGAGCTCACACCATCGGCTTCGCTCAC
TGCAAGGAATTCATGAGCCGGATCTACAACTTCAACAGCACTCACCAATTCGATCCCGCAATGGATCCCAACTTCGCCAAGGATTTGCGGCTCACTTGCCCCCAGTCAGTGGATCCAAGA
GTGGTCGCCAACAACGACGTGACCACCCCCGCCAAATTCGACAACGTCTACTACCAAAACGCTGTGAGAGGAGTCACGGTGCTCGCCTCGGACCAAATCCTCCACAGCGACGCTAGAACA
AGGGGCCTCGTCACGGCATACGCCGGCCAGCAGGGCGCATTCTTCGCCGCGTTCGCCACCGCCATGGACAACCTGGGAGCCGTCGGCGTCAAGACTGGAAACCAGGGAGAAATCCGAAAG
GACTGCTCCAGATTCAACAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAGTACCAGTCCAGGCCTCTTGTCTTGTTGCTTTGCTGCTGCTACTCCTCTTTGGATCCGGCATTCATGCCCAGCTCTCTCCAGGCTACTACAGCAGCTCCTGCCCCAATGTGGAG
TCTATCATCCAGCAAGTGATGCTCCAGAAATTCAAGATCACACCCAACAGCGTCCCTGGCACGCTGCGGCTCTTCTTCCACGACTGCTTTGTCGAT
GGATGCGATGCCTCGGTGCTCATC
GCTTCCACGGCCAGCAACAGCGCAGAGAAGGATTCCGAGATCAACTTGTCGCTGGCAGGCGATGGCTTCGACTCGGTCATCAAAGCCAAAGCTGCTGTTGAGGAGAAGTGCCCCGGGATC
GTCTCTTGCGCGGACATTCTCGCCATTGCGACCAGGGACCTCGTTGTGCTG
GCAGGAGGACCATCTTGGACAGTGAGGAAAGGCCGCAAAGATGGAAAGATCTCGCAAGCTTCAAGAGTC
GACGGTAACTTGCCAAAGCCCGAGCAATCGGTCGACCAGCTCACCAAGCTCTTCGCTTCCAAAGGACTCTCTCAAACGGACATGGTGGCTCTCTCAG
GAGCTCACACCATCGGCTTCGCT
CACTGCAAGGAATTCATGAGCCGGATCTACAACTTCAACAGCACTCACCAATTCGATCCCGCAATGGATCCCAACTTCGCCAAGGATTTGCGGCTCACTTGCCCCCAGTCAGTGGATCCA
AGAGTGGTCGCCAACAACGACGTGACCACCCCCGCCAAATTCGACAACGTCTACTACCAAAACGCTGTGAGAGGAGTCACGGTGCTCGCCTCGGACCAAATCCTCCACAGCGACGCTAGA
ACAAGGGGCCTCGTCACGGCATACGCCGGCCAGCAGGGCGCATTCTTCGCCGCGTTCGCCACCGCCATGGACAACCTGGGAGCCGTCGGCGTCAAGACTGGAAACCAGGGAGAAATCCGA
AAGGACTGCTCCAGATTCAACAGCTAG

Retrieve as FASTA