Entry information : SmPrx14-1_0 (SmPrx14a_0)
Entry ID 7007
Creation 2009-10-06 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx14-1_0 (SmPrx14a_0)
Name (synonym) SmPrx14-1_0 (SmPrx14a_0)
Class Class III peroxidase    [Orthogroup: Prx047]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx14-1_0
start..stop
S start..stop
SmPrx13-1_0 687 0 1..332 1..332
SmPrx13-2_57 683 0 1..332 1..332
SmPrx14-2_57 644 0 1..332 1..332
SmPrx30-2_131 419 4e-148 7..332 10..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6899621..6899848 228 N° 2 6899903..6900100 198 N° 3 6900159..6900321 163 N° 4 6900401..6900810 410
join(6899621..6899848,6899903..6900100,6900159..6900321,6900401..6900810)


exon

Literature and cross-references SmPrx14-1_0 (SmPrx14a_0)
DNA ref. Phytozome 12:   scaffold_0 (6899621..6900810)
mRNA ref. JGI transcript:   73829 [Incorrect prediction]
Protein sequence: SmPrx14-1_0 (SmPrx14a_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (310)
PWM (Da):   %s   36401.29 (34035.9) Transmb domain:   %s   i7-24o
PI (pH):   %s   8.89 (8.89) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METWRGSVLVLLLLSLSLGILAHGESGGRKHGYHSYSRSCPQAERIIRDTLSKHAGWDRTIPAGVLRLHFHDCFVDGCDGSILLDSTPTDGTKVEKLSLPNFMSARGFEVIEEAKQRLEAACPGVVSCADTLAIAARDSTVMLGGKYYQVPTGRYDGRVSSQERGNTLPSPFGDASALIQNFKERGLSVQDLVVLSGGHTLGTAGCATFSNRLDNFTKTGKPDPTINPRYLSHLRRQCPAPGSPNRVELDKGSEFVFDNSYHKNLARRNGVLMSDQVLNEDSRTSHYVKNLAHKQHDFLSQFAASMVKMGYIGWKNKHNGEIRRVCSMVNTH

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Duplication of SmPrx13a. Incorrect prediction from JGI (exon 1 is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTTGGAGAGGGAGCGTTTTGGTTTTGCTCCTGCTGTCACTGAGCTTGGGTATCTTGGCTCACGGTGAGAGTGGAGGACGCAAGCATGGCTACCACAGCTACTCGAGATCTTGT
CCTCAGGCCGAGAGGATCATAAGGGACACTCTAAGCAAGCACGCCGGTTGGGACAGGACGATACCAGCAGGAGTTCTTCGCTTGCACTTCCACGACTGTTTCGTCGAC
GTGAGTAGCTTT
ACAAGATTTAAATTCTGGTTTTCTAACTTTGCTGTTCTCCAGGGCTGTGATGGATCGATTCTTCTCGACTCAACTCCCACCGACGGAACTAAAGTGGAAAAATTGTCCCTTCCAAACTTC
ATGTCCGCCAGGGGCTTCGAGGTGATTGAGGAAGCAAAGCAGAGGTTGGAAGCAGCTTGTCCTGGAGTTGTCTCCTGTGCCGACACTCTCGCCATAGCTGCCAGAGACTCGACCGTCATG
GTAAGCTTAGCATCTTTTGAGAAACGCCGAATCAAGTTCTAAGACGTTGTCACTGCAGCTTGGAGGAAAGTATTACCAAGTCCCAACCGGACGCTACGACGGAAGAGTTTCCAGCCAGGA
ACGTGGCAACACCTTACCATCCCCGTTTGGCGATGCATCGGCTCTCATTCAAAACTTCAAGGAGCGCGGCTTGTCAGTCCAGGACCTCGTCGTTCTCTCAG
GTACGAATCGATTTCAACT
TCCATCTCCTTCCCTCCAGTTTGTAAGTAGGCATTAACGCTACTCCCTTGCAAACCACAGGTGGTCACACTCTTGGTACCGCCGGCTGCGCCACATTCAGCAATCGTTTGGACAACTTTA
CGAAAACTGGCAAGCCGGACCCGACCATCAATCCCAGATACCTCTCTCATCTCCGGAGGCAGTGCCCAGCACCGGGGTCGCCAAACCGTGTGGAGCTGGACAAAGGCTCGGAGTTTGTGT
TCGACAACAGCTACCACAAGAACTTGGCCAGGAGAAACGGGGTCCTCATGTCGGATCAAGTTCTCAACGAGGACTCGAGAACAAGTCACTACGTCAAGAACCTTGCGCACAAGCAGCACG
ACTTTTTGTCGCAGTTTGCGGCCTCGATGGTGAAGATGGGATACATTGGGTGGAAGAACAAGCACAATGGGGAAATCAGGAGGGTCTGCTCCATGGTAAACACCCATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTTGGAGAGGGAGCGTTTTGGTTTTGCTCCTGCTGTCACTGAGCTTGGGTATCTTGGCTCACGGTGAGAGTGGAGGACGCAAGCATGGCTACCACAGCTACTCGAGATCTTGT
CCTCAGGCCGAGAGGATCATAAGGGACACTCTAAGCAAGCACGCCGGTTGGGACAGGACGATACCAGCAGGAGTTCTTCGCTTGCACTTCCACGACTGTTTCGTCGAC
GGCTGTGATGGA
TCGATTCTTCTCGACTCAACTCCCACCGACGGAACTAAAGTGGAAAAATTGTCCCTTCCAAACTTCATGTCCGCCAGGGGCTTCGAGGTGATTGAGGAAGCAAAGCAGAGGTTGGAAGCA
GCTTGTCCTGGAGTTGTCTCCTGTGCCGACACTCTCGCCATAGCTGCCAGAGACTCGACCGTCATG
CTTGGAGGAAAGTATTACCAAGTCCCAACCGGACGCTACGACGGAAGAGTTTCC
AGCCAGGAACGTGGCAACACCTTACCATCCCCGTTTGGCGATGCATCGGCTCTCATTCAAAACTTCAAGGAGCGCGGCTTGTCAGTCCAGGACCTCGTCGTTCTCTCAG
GTGGTCACACT
CTTGGTACCGCCGGCTGCGCCACATTCAGCAATCGTTTGGACAACTTTACGAAAACTGGCAAGCCGGACCCGACCATCAATCCCAGATACCTCTCTCATCTCCGGAGGCAGTGCCCAGCA
CCGGGGTCGCCAAACCGTGTGGAGCTGGACAAAGGCTCGGAGTTTGTGTTCGACAACAGCTACCACAAGAACTTGGCCAGGAGAAACGGGGTCCTCATGTCGGATCAAGTTCTCAACGAG
GACTCGAGAACAAGTCACTACGTCAAGAACCTTGCGCACAAGCAGCACGACTTTTTGTCGCAGTTTGCGGCCTCGATGGTGAAGATGGGATACATTGGGTGGAAGAACAAGCACAATGGG
GAAATCAGGAGGGTCTGCTCCATGGTAAACACCCATTAA

Retrieve as FASTA