Entry information : SmPrx28-1_10 (SmPrx28a_10)
Entry ID 7013
Creation 2009-10-16 (Christophe Dunand)
Last sequence changes 2009-10-16 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: SmPrx28-1_10 (SmPrx28a_10)
Name (synonym) SmPrx28-1_10 (SmPrx28a_10)
Class Class III peroxidase    [Orthogroup: Prx280]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx28-1_10
start..stop
S start..stop
SmPrx28-2_6 674 0 1..332 1..332
PtaPrx09 315 2e-107 5..331 7..324
AtPrx56 311 1e-105 1..331 1..329
PabPrx108 310 2e-105 29..331 30..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 314424..314487 64 N° 2 314197..314363 167 N° 3 313948..314133 186 N° 4 313732..313894 163
N° 5 313263..313681 419  
complement(join(313263..313681,313732..313894,313948..314133,314197..314363,3144 24..314487))


exon

Literature and cross-references SmPrx28-1_10 (SmPrx28a_10)
DNA ref. Phytozome 12:   scaffold_10 (314487..313263)
mRNA ref. JGI transcript:   409154
Protein sequence: SmPrx28-1_10 (SmPrx28a_10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (310)
PWM (Da):   %s   35149.01 (33033.9) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.57 (8.59) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAKSVVLVVISCCLIAASNAQNIFSPLMLGYYNRPGICKQNPEVIIQQIVNGSVAADRTLAAGLLRMHFHDAFVGTEASVLLKSPNNDAERNAIPNLSLRGFEVIDAAKAAVEKVCPNVVSCADILALAARDSVVAIGGPWWPVPTGRRDGVQSHASETTDLPPPSANFTQLLSMFQKKNLDKVDLVALSAAHTIGRGHCGAFSSRIYDAAGNNAIDPTLDAAYANKLRGFCPPRDTVTTVEMDPNSSLNFDSHYFQAVLAKQGLFKSDAALLTDAGARSLVQTGASAPIIFKSQFGFSMTKMGKIGVLTGRPGEPPSQIRKQCAFVNP

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns: extra 5' introns). No EST. Missing 'c'. containing motif fhda. Containing IntR (5').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCGAAGTCCGTCGTTCTGGTCGTAATATCATGCTGCCTGATTGCTGCGAGCAATGGTATGAATTTTCCTTCGTTCTTCCCAAGAGATAAATTTGGTGGCTTTCCGTCGTTC
CCAGCGCAAAACATATTTTCTCCGTTGATGTTGGGTTACTACAATCGTCCCGGAATCTGCAAACAAAATCCAGAAGTTATTATCCAACAAATTGTAAATGGTTCTGTTGCTGCCGACCGT
ACTTTAGCAGCGGGCCTCCTCCGGATGCATTTTCATGATGCTTTCGTCAGG
GTGTGTAGTCATCTTTCCAAGTAGTTTTGTATGGATAGCTGAAAAATGTTGTCCTGTTGCCAGGGTACT
GAAGCTTCGGTGCTGCTCAAGTCTCCAAACAATGACGCCGAGAGAAATGCCATTCCAAATCTCAGCTTGAGAGGTTTCGAGGTGATCGACGCAGCAAAAGCCGCGGTGGAGAAAGTTTGT
CCCAATGTAGTCTCTTGTGCTGATATTCTTGCTCTGGCGGCACGCGACAGTGTTGTAGCT
GTAAGCAAAATGACCAGGATCAGTCGCTCAAAGTTCTAACGGTTTCGATTCAGATTGGTG
GACCTTGGTGGCCAGTTCCAACTGGTCGCCGCGACGGAGTCCAAAGTCATGCCAGCGAGACGACGGATTTGCCACCACCTTCTGCAAACTTCACTCAGCTTCTCAGCATGTTCCAGAAAA
AGAACCTCGACAAGGTTGATCTTGTTGCCCTGTCAG
GTACGTATCACATAACTCAGTAGCAGTCTTCGCTGATAATATTGCCACAGCTGCACATACCATTGGAAGAGGTCACTGTGGTGC
TTTCTCCAGCCGCATTTACGATGCCGCTGGTAACAATGCTATCGATCCCACACTGGACGCAGCTTATGCCAACAAGCTGAGAGGCTTCTGCCCGCCAAGAGATACAGTAACCACCGTAGA
AATGGATCCCAATAGCAGCCTCAACTTCGACAGTCACTACTTCCAGGCGGTACTCGCAAAACAGGGCCTCTTCAAATCGGACGCGGCGTTGCTTACTGACGCTGGTGCTCGAAGCCTTGT
TCAAACGGGTGCTAGCGCTCCTATCATTTTCAAGTCCCAGTTTGGATTCTCTATGACCAAGATGGGCAAGATTGGCGTACTCACGGGACGTCCAGGAGAACCTCCGAGCCAAATTAGAAA
ACAGTGCGCTTTTGTGAACCCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCGAAGTCCGTCGTTCTGGTCGTAATATCATGCTGCCTGATTGCTGCGAGCAATGCGCAAAACATATTTTCTCCGTTGATGTTGGGTTACTACAATCGTCCCGGAATCTGC
AAACAAAATCCAGAAGTTATTATCCAACAAATTGTAAATGGTTCTGTTGCTGCCGACCGTACTTTAGCAGCGGGCCTCCTCCGGATGCATTTTCATGATGCTTTCGTCAGG
GGTACTGAA
GCTTCGGTGCTGCTCAAGTCTCCAAACAATGACGCCGAGAGAAATGCCATTCCAAATCTCAGCTTGAGAGGTTTCGAGGTGATCGACGCAGCAAAAGCCGCGGTGGAGAAAGTTTGTCCC
AATGTAGTCTCTTGTGCTGATATTCTTGCTCTGGCGGCACGCGACAGTGTTGTAGCT
ATTGGTGGACCTTGGTGGCCAGTTCCAACTGGTCGCCGCGACGGAGTCCAAAGTCATGCCAGC
GAGACGACGGATTTGCCACCACCTTCTGCAAACTTCACTCAGCTTCTCAGCATGTTCCAGAAAAAGAACCTCGACAAGGTTGATCTTGTTGCCCTGTCAG
CTGCACATACCATTGGAAGA
GGTCACTGTGGTGCTTTCTCCAGCCGCATTTACGATGCCGCTGGTAACAATGCTATCGATCCCACACTGGACGCAGCTTATGCCAACAAGCTGAGAGGCTTCTGCCCGCCAAGAGATACA
GTAACCACCGTAGAAATGGATCCCAATAGCAGCCTCAACTTCGACAGTCACTACTTCCAGGCGGTACTCGCAAAACAGGGCCTCTTCAAATCGGACGCGGCGTTGCTTACTGACGCTGGT
GCTCGAAGCCTTGTTCAAACGGGTGCTAGCGCTCCTATCATTTTCAAGTCCCAGTTTGGATTCTCTATGACCAAGATGGGCAAGATTGGCGTACTCACGGGACGTCCAGGAGAACCTCCG
AGCCAAATTAGAAAACAGTGCGCTTTTGTGAACCCGTAA

Retrieve as FASTA