Entry information : SmPrx16-1_0 (SmPrx16a_0)
Entry ID 7015
Creation 2009-10-07 (Paula Nunes)
Last sequence changes 2009-10-07 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx16-1_0 (SmPrx16a_0)
Name (synonym) SmPrx16-1_0 (SmPrx16a_0)
Class Class III peroxidase    [Orthogroup: Prx072]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx16-1_0
start..stop
S start..stop
SmPrx16-2_8 665 0 1..325 1..325
ApuncPrx18 370 6.65e-129 23..325 30..333
GbPrx55 346 1.04e-119 23..312 22..310
PpaPrx24 314 8.36e-107 13..325 13..330
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7015' 'join(4888423..4888641,4888757..4888948,4889010..4889175,4889231..4889631)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4888423..4888641 217 N° 2 4888757..4888948 190 N° 3 4889010..4889175 164 N° 4 4889231..4889631 399
join(4888423..4888641,4888757..4888948,4889010..4889175,4889231..4889631)


exon

Literature and cross-references SmPrx16-1_0 (SmPrx16a_0)
DNA ref. Phytozome 12:   scaffold_0 (4888423..4889631)
mRNA ref. JGI transcript:   229953 [3' end]
Protein sequence: SmPrx16-1_0 (SmPrx16a_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (227)
PWM (Da):   %s   35536.69 (23664.3)  
PI (pH):   %s   4.68 (7.79) Peptide Signal:   %s   cut: 29 range:29-255
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MELVVRKAVAALVVSVVVTLVHVEAQLVVGYYEQNGCPMAEEIVK
KVLTAAVARDQSIAASLLRLHFHDCFVQ
GCDGSVLLDPQNGFPATEKQAVPNFSLRGYNVVDAVKQALEQACPETVSCADILAIAARDAVSLSGGGTWPVETGRKDGVISLRTEAEDLLPPTNENSEELTQRFLDVGLTQDEMITLSG
AHTIGRAHCVSFSQRLYNFSPEFDTDPNLDAAYAGKLKQACPRNFDPRTVVPLDPVTPSQFDNRYYSNLVNNMGLMISDQTLHSDMLTQFSSQSNAEDENMWQFKFANAMVRMGAINVKA
EGEIRKNCRLRN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from JGI (PS is missing). No EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCTCGTCGTCCGCAAAGCAGTAGCAGCATTGGTGGTGAGTGTTGTTGTCACGCTTGTCCATGTGGAAGCTCAGCTCGTTGTTGGATACTACGAGCAAAATGGATGTCCCATGGCC
GAGGAGATTGTCAAGAAAGTTCTCACCGCGGCCGTGGCACGAGACCAATCCATCGCTGCTTCGTTGCTTCGTCTCCACTTCCACGACTGTTTCGTCCAG
AGGTCCGTGAGCAACTTCTGT
CTCGCCTTTCATCTCGGCAGCATCGTTATCGATTTGAAAAATCCGTAGTCACTGAAAGAATTCTTGCTCACCAATCGCCGCCAACTTGATGAACAGGGCTGTGACGGGTCCGTTCTCTTG
GATCCACAAAACGGCTTCCCCGCCACGGAGAAACAAGCTGTCCCAAACTTCTCGCTCCGAGGATACAACGTCGTCGACGCAGTAAAGCAAGCTCTCGAACAAGCGTGTCCAGAGACTGTC
TCATGTGCTGACATTCTCGCTATAGCAGCCCGAGATGCTGTTTCCCTG
TGGTAAGAACTCCTGCTTCGTAAGATTTCTTTCGAGAACTTGACGAAGAATGCTTACCACCAGTCTGGAGGA
GGAACTTGGCCAGTGGAAACAGGACGTAAAGATGGTGTTATTTCACTCAGGACCGAAGCGGAGGACCTTCTTCCTCCCACGAACGAAAACTCTGAAGAGTTAACCCAGAGGTTCCTTGAT
GTTGGTCTGACTCAAGATGAGATGATCACCTTGTCCG
CGGTAAAGTTTCATAAGTTTGCTCTCGGCCTGCCACTGATCTTCTTCCAACTTCCAGGAGCACATACGATAGGACGAGCTCAC
TGTGTCTCTTTCAGCCAGAGGCTCTATAACTTCAGCCCGGAGTTTGATACTGATCCGAATCTCGACGCTGCTTACGCCGGGAAACTAAAGCAGGCCTGTCCGAGGAACTTTGATCCGAGA
ACTGTCGTGCCGCTGGATCCTGTCACCCCTTCCCAGTTTGACAATCGCTACTACTCCAACCTCGTCAACAACATGGGGCTCATGATCTCAGATCAGACGCTCCACAGCGACATGCTCACC
CAGTTTTCTTCCCAGTCAAACGCCGAGGATGAAAACATGTGGCAGTTTAAGTTCGCAAACGCCATGGTCCGGATGGGTGCTATTAACGTCAAGGCTGAAGGCGAGATTCGCAAAAACTGC
CGACTGAGGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCTCGTCGTCCGCAAAGCAGTAGCAGCATTGGTGGTGAGTGTTGTTGTCACGCTTGTCCATGTGGAAGCTCAGCTCGTTGTTGGATACTACGAGCAAAATGGATGTCCCATGGCC
GAGGAGATTGTCAAGAAAGTTCTCACCGCGGCCGTGGCACGAGACCAATCCATCGCTGCTTCGTTGCTTCGTCTCCACTTCCACGACTGTTTCGTCCAG
GGCTGTGACGGGTCCGTTCTC
TTGGATCCACAAAACGGCTTCCCCGCCACGGAGAAACAAGCTGTCCCAAACTTCTCGCTCCGAGGATACAACGTCGTCGACGCAGTAAAGCAAGCTCTCGAACAAGCGTGTCCAGAGACT
GTCTCATGTGCTGACATTCTCGCTATAGCAGCCCGAGATGCTGTTTCCCTG
TCTGGAGGAGGAACTTGGCCAGTGGAAACAGGACGTAAAGATGGTGTTATTTCACTCAGGACCGAAGCG
GAGGACCTTCTTCCTCCCACGAACGAAAACTCTGAAGAGTTAACCCAGAGGTTCCTTGATGTTGGTCTGACTCAAGATGAGATGATCACCTTGTCCG
GAGCACATACGATAGGACGAGCT
CACTGTGTCTCTTTCAGCCAGAGGCTCTATAACTTCAGCCCGGAGTTTGATACTGATCCGAATCTCGACGCTGCTTACGCCGGGAAACTAAAGCAGGCCTGTCCGAGGAACTTTGATCCG
AGAACTGTCGTGCCGCTGGATCCTGTCACCCCTTCCCAGTTTGACAATCGCTACTACTCCAACCTCGTCAACAACATGGGGCTCATGATCTCAGATCAGACGCTCCACAGCGACATGCTC
ACCCAGTTTTCTTCCCAGTCAAACGCCGAGGATGAAAACATGTGGCAGTTTAAGTTCGCAAACGCCATGGTCCGGATGGGTGCTATTAACGTCAAGGCTGAAGGCGAGATTCGCAAAAAC
TGCCGACTGAGGAACTAG

Retrieve as FASTA