Entry information : SmPrx17-1_0 (SmPrx17a_0)
Entry ID 7016
Creation 2009-10-07 (Paula Nunes)
Last sequence changes 2011-02-02 (Toky Ramarohetra)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-08-12 (Christophe Dunand)
Peroxidase information: SmPrx17-1_0 (SmPrx17a_0)
Name (synonym) SmPrx17-1_0 (SmPrx17a_0)
Class Class III peroxidase     [Orthogroup: Prx027]*
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx17-1_0
start..stop
S start..stop
SmPrx[P]17b10_8 386 5e-136 138..323 98..283
SmPrx[P]17b10_8 82 4e-18 1..38 1..38
SmPrx54-1_5 370 7e-129 4..323 1..329
SmPrx54-2_1 369 8e-129 4..323 1..329
PabPrx86 362 1e-125 12..323 6..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5004853..5005068 216 N° 2 5005194..5005388 195 N° 3 5005452..5005617 166 N° 4 5005749..5006143 395
join(5004853..5005068,5005194..5005388,5005452..5005617,5005749..5006143)


exon

Literature and cross-references SmPrx17-1_0 (SmPrx17a_0)
DNA ref. JGI genome:   scaffold_0 (5005086..5006373)
mRNA ref. JGI transcript:   164271
EST ref. GenBank:   FE450206.1 [5' end]
Protein sequence: SmPrx17-1_0 (SmPrx17a_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (298)
PWM (Da):   %s   35109.84 (32392.4)  
PI (pH):   %s   9 (9.29) Peptide Signal:   %s   cut: 26 range:26-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERIKGSTCLVLMLVAVIMVDLCQAQLSTTFYSKSCPRVKAIVKDAMQKKFSETRVVAAGTLRLFFHDCMIEGCDGSVIIASTNTNKAEKDADDNLSLPGDAFDAVFRAKAAVEKQCPNTVSCADILTMATSELLQLIGGRGWDVRLGRKDGRVSLASRVPGNLPNVNMSVAQLTSFFKTRGFSQRELVVLSGGHSAGFAHCNKFMDRIYGRIDPTMDTGYARGLRGTCPQRNLDPTVVANLDTTTSTTFDNVFYQNLKSKKGLLRSDQVLYTDPNTKKVVDSFASDNTAFLIEFAAVMDKLSAFKVKTGSQGEIRKNCGVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and ESTs
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGAATCAAAGGATCTACTTGCCTGGTCTTGATGCTTGTCGCCGTGATAATGGTTGATCTGTGCCAAGCCCAGCTCTCCACCACTTTCTACTCCAAATCCTGCCCGAGAGTAAAG
GCTATTGTCAAGGACGCAATGCAGAAGAAGTTCAGCGAGACCAGAGTTGTAGCCGCTGGAACACTCCGACTTTTCTTCCACGATTGCATGATAGAG
GTCTGCTCCCAATTTCCAGTTCCT
GGATTGTTCCTCTCAGCCCCGATTGTTCCTCCACTTGAATTTCCCAAGCTTTGCCTGCTGAATTGTTTAATTGCCGATAGCTGACCACAACTCCTGTCCAGGGATGCGATGGTTCAGTCA
TAATTGCCTCTACGAACACGAACAAAGCCGAGAAGGACGCAGACGACAATCTTTCGCTTCCTGGAGATGCCTTCGACGCTGTTTTCAGAGCTAAAGCCGCAGTCGAGAAGCAATGCCCGA
ACACAGTCTCCTGTGCTGACATCCTCACCATGGCCACCAGCGAACTTCTCCAGCTC
GTAAGCATCAATCGATAAGTATACCGGCATCGCCTCACTGACACTTTCCCCTGTGCTTCAAAGA
TTGGAGGACGCGGCTGGGATGTAAGGCTTGGAAGAAAAGACGGCAGAGTGTCACTAGCTTCGAGAGTTCCCGGGAATTTGCCGAACGTAAACATGTCAGTTGCTCAGCTCACTTCATTCT
TTAAAACTCGAGGATTCAGCCAAAGAGAATTGGTCGTCTTGTCCG
GTAAGTTTTTGAAAACCGCCCCTGTGACCCTGTTAAATTCCCCTGTCCCGTGTTACGCATCTTCGATCATGCCTG
TTCCTGATTTTCCTGTTCCTCCTTGTTTCCCTGACCAATTTTCCTCCACTGAGCAGGAGGCCACAGTGCTGGTTTTGCTCACTGCAACAAGTTCATGGACCGGATTTATGGCAGAATTGA
TCCAACCATGGATACCGGTTACGCCAGGGGTCTCAGAGGTACATGTCCCCAAAGGAATCTGGACCCGACTGTCGTTGCCAATCTCGACACCACCACTTCCACCACGTTTGACAATGTCTT
CTACCAAAACCTCAAGAGCAAAAAGGGCCTTCTCCGCTCCGATCAAGTGCTATACACCGACCCGAACACTAAGAAAGTCGTGGACTCGTTTGCCTCCGACAACACTGCCTTTCTCATTGA
GTTCGCCGCGGTCATGGACAAGTTGAGTGCCTTCAAGGTAAAGACAGGCTCTCAAGGTGAAATCCGGAAAAACTGCGGGGTGATCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGAATCAAAGGATCTACTTGCCTGGTCTTGATGCTTGTCGCCGTGATAATGGTTGATCTGTGCCAAGCCCAGCTCTCCACCACTTTCTACTCCAAATCCTGCCCGAGAGTAAAG
GCTATTGTCAAGGACGCAATGCAGAAGAAGTTCAGCGAGACCAGAGTTGTAGCCGCTGGAACACTCCGACTTTTCTTCCACGATTGCATGATAGAG
GGATGCGATGGTTCAGTCATAATT
GCCTCTACGAACACGAACAAAGCCGAGAAGGACGCAGACGACAATCTTTCGCTTCCTGGAGATGCCTTCGACGCTGTTTTCAGAGCTAAAGCCGCAGTCGAGAAGCAATGCCCGAACACA
GTCTCCTGTGCTGACATCCTCACCATGGCCACCAGCGAACTTCTCCAGCTC
ATTGGAGGACGCGGCTGGGATGTAAGGCTTGGAAGAAAAGACGGCAGAGTGTCACTAGCTTCGAGAGTT
CCCGGGAATTTGCCGAACGTAAACATGTCAGTTGCTCAGCTCACTTCATTCTTTAAAACTCGAGGATTCAGCCAAAGAGAATTGGTCGTCTTGTCCG
GAGGCCACAGTGCTGGTTTTGCT
CACTGCAACAAGTTCATGGACCGGATTTATGGCAGAATTGATCCAACCATGGATACCGGTTACGCCAGGGGTCTCAGAGGTACATGTCCCCAAAGGAATCTGGACCCGACTGTCGTTGCC
AATCTCGACACCACCACTTCCACCACGTTTGACAATGTCTTCTACCAAAACCTCAAGAGCAAAAAGGGCCTTCTCCGCTCCGATCAAGTGCTATACACCGACCCGAACACTAAGAAAGTC
GTGGACTCGTTTGCCTCCGACAACACTGCCTTTCTCATTGAGTTCGCCGCGGTCATGGACAAGTTGAGTGCCTTCAAGGTAAAGACAGGCTCTCAAGGTGAAATCCGGAAAAACTGCGGG
GTGATCAATTAG

Retrieve as FASTA