Entry information : SmPrx15-1_0 (SmPrx15a_0)
Entry ID 7017
Creation 2009-10-07 (Paula Nunes)
Last sequence changes 2009-10-07 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx15-1_0 (SmPrx15a_0)
Name (synonym) SmPrx15-1_0 (SmPrx15a_0)
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx15-1_0
start..stop
S start..stop
SmPrx15-2_60 672 0 1..329 1..329
SmPrx106-2_43 399 8.28e-140 26..323 58..356
SmPrx106-1_173 398 2.24e-139 26..323 54..352
GbPrx04 380 5.43e-133 26..326 28..329
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7017' 'complement(join(643261..643679,643734..643899,643978..644169,644223..644435))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 644223..644435 211 N° 2 643978..644169 190 N° 3 643734..643899 164 N° 4 643261..643679 417
complement(join(643261..643679,643734..643899,643978..644169,644223..644435))


exon

Literature and cross-references SmPrx15-1_0 (SmPrx15a_0)
DNA ref. Phytozome 12:   scaffold_0 (644435..643261)
mRNA ref. JGI transcript:   229828
Protein sequence: SmPrx15-1_0 (SmPrx15a_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (308)
PWM (Da):   %s   35724.03 (33603.9)  
PI (pH):   %s   5.6 (5.85) Peptide Signal:   %s   cut: 22 range:22-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALAFVFTSVLVALVCIVDGHPLKLVPDYYASTCPEAEAIVRAV
VEKAVIREARNAASLLRLHFHDCFVN
GCDGSVLLDDTPTFTGEKMAAPNNGSIRALDVVDEIKAELESHCHGVVSCADVLAIAARDSVVVSGGPFYEVLLGRRDSLTASQAAANNSIPPPTSNITGLISSFRAVGLSVLDLVVLSG
AHTIGRARCTNVVQRLYNQSGTFRADPTIENDFLGYLVELCPQRGNPNTLANLDFVSPIYFDNHYFRNLQYFKGLLNSDEVLFTTSKETKELVNLFSDNKEAFFKHFPDSMIRMGNISPL
TGDRGEVRFNCRYTNSGQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGCTTGCTTTCGTCTTCACCAGCGTCCTGGTTGCTCTTGTTTGCATTGTCGACGGCCACCCGCTGAAGCTCGTCCCCGACTACTATGCCTCGACTTGTCCTGAAGCCGAGGCC
ATCGTTAGAGCTGTCGTGGAGAAGGCAGTGATCAGGGAGGCCAGGAACGCGGCGTCGCTGCTAAGGCTACACTTCCACGACTGTTTCGTCAAT
GTAAGTTGGACGCTGCTCTTTCTTTCT
TCCGGCGCTAATGCTCTCCTTTGCAGGGGGCTGTGATGGATCTGTTCTGCTGGACGACACTCCAACTTTCACCGGAGAGAAGATGGCAGCCCCCAACAATGGCTCCATTCGAGCTCTCGA
CGTGGTGGACGAGATCAAAGCCGAGCTCGAGAGCCATTGTCACGGAGTAGTGTCGTGTGCTGATGTGTTGGCGATCGCAGCCAGGGACTCCGTCGTCGTG
GTAAGTAAGCAAGAAGTAAT
TTTCTTATGCTTCATGAATAACACGCCTGATTGTTTTCTTTTGTTTTTCCTTCTCTAGAGAGCGGTGGTCCTTTCTACGAAGTTCTTCTTGGAAGACGGGATAGCTTAACTGCCAGCCAA
GCCGCTGCCAACAATTCGATCCCACCTCCCACGTCCAACATCACGGGATTGATCTCGAGCTTCAGGGCCGTGGGATTATCCGTGCTCGATCTAGTTGTTCTCTCTG
GTAAGCTTGTCCAG
CAGCGAGTAAAGAGCTAAACGCATTGAAACTTTCATCCAGGCGCGCTCACACAATCGGCCGAGCTCGTTGCACCAACGTCGTCCAGCGTCTCTACAACCAGAGTGGAACGTTTCGTGCTG
ATCCAACCATCGAGAACGACTTCCTGGGATATCTCGTGGAGCTGTGCCCGCAGCGAGGCAATCCAAACACTCTCGCCAACCTCGACTTCGTGAGCCCGATCTACTTCGACAATCACTACT
TCCGGAACCTCCAGTACTTCAAGGGCCTGCTCAACTCGGACGAGGTTCTCTTCACCACTTCCAAGGAGACGAAAGAGCTCGTCAACCTCTTTAGCGACAACAAGGAGGCCTTCTTCAAGC
ACTTCCCAGACTCGATGATCCGGATGGGAAACATCAGCCCTCTCACTGGCGATCGCGGCGAGGTGAGATTCAATTGCCGATACACCAACAGCGGGCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGCTTGCTTTCGTCTTCACCAGCGTCCTGGTTGCTCTTGTTTGCATTGTCGACGGCCACCCGCTGAAGCTCGTCCCCGACTACTATGCCTCGACTTGTCCTGAAGCCGAGGCC
ATCGTTAGAGCTGTCGTGGAGAAGGCAGTGATCAGGGAGGCCAGGAACGCGGCGTCGCTGCTAAGGCTACACTTCCACGACTGTTTCGTCAAT
GGCTGTGATGGATCTGTTCTGCTGGAC
GACACTCCAACTTTCACCGGAGAGAAGATGGCAGCCCCCAACAATGGCTCCATTCGAGCTCTCGACGTGGTGGACGAGATCAAAGCCGAGCTCGAGAGCCATTGTCACGGAGTAGTGTCG
TGTGCTGATGTGTTGGCGATCGCAGCCAGGGACTCCGTCGTCGTG
AGCGGTGGTCCTTTCTACGAAGTTCTTCTTGGAAGACGGGATAGCTTAACTGCCAGCCAAGCCGCTGCCAACAAT
TCGATCCCACCTCCCACGTCCAACATCACGGGATTGATCTCGAGCTTCAGGGCCGTGGGATTATCCGTGCTCGATCTAGTTGTTCTCTCTG
GCGCTCACACAATCGGCCGAGCTCGTTGC
ACCAACGTCGTCCAGCGTCTCTACAACCAGAGTGGAACGTTTCGTGCTGATCCAACCATCGAGAACGACTTCCTGGGATATCTCGTGGAGCTGTGCCCGCAGCGAGGCAATCCAAACACT
CTCGCCAACCTCGACTTCGTGAGCCCGATCTACTTCGACAATCACTACTTCCGGAACCTCCAGTACTTCAAGGGCCTGCTCAACTCGGACGAGGTTCTCTTCACCACTTCCAAGGAGACG
AAAGAGCTCGTCAACCTCTTTAGCGACAACAAGGAGGCCTTCTTCAAGCACTTCCCAGACTCGATGATCCGGATGGGAAACATCAGCCCTCTCACTGGCGATCGCGGCGAGGTGAGATTC
AATTGCCGATACACCAACAGCGGGCAGTAA

Retrieve as FASTA