Entry information : SmPrx16-2_8 (SmPrx16b_8)
Entry ID 7018
Creation 2009-10-08 (Christophe Dunand)
Last sequence changes 2009-10-08 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: SmPrx16-2_8 (SmPrx16b_8)
Name (synonym) SmPrx16-2_8 (SmPrx16b_8)
Class Class III peroxidase    [Orthogroup: Prx066]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx16-2_8
start..stop
S start..stop
SmPrx16-1_0 635 0 1..325 1..325
ApuncPrx18 368 3e-128 23..325 30..333
GbPrx55 345 3e-119 23..312 22..310
AfiliPrx23 311 6e-106 28..325 44..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 483207..483425 219 N° 2 482900..483091 192 N° 3 482672..482837 166 N° 4 482216..482616 401
complement(join(482216..482616,482672..482837,482900..483091,483207..483425))


exon

Literature and cross-references SmPrx16-2_8 (SmPrx16b_8)
DNA ref. Phytozome 12:   scaffold_8 (483425..482216)
mRNA ref. JGI transcript:   168621
EST ref. GenBank:   FE507960.1 [3' end]   FE507961.1 [Fragment]
Protein sequence: SmPrx16-2_8 (SmPrx16b_8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325
PWM (Da):   %s   35581.8  
PI (pH):   %s   4.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MELVVRKAVAALVVSVVVTLVRVEAQLVVGYYEQNGCPMAEEIVKKVLTAAVARDQSIAASLLRLHFHDCFVQGCDGSVLLDPQNGFPATEKQAVPNFSLRGYNLVDAIKQALEQACPETVSCADILAIAARDAVSLSGGGTWPVETGRRDGVISLRTEAENLLPPTNENSEVLTQRFLDVGLTQDEMITLSGAHTIGRAHCVSFSQRLYNFSPEFDTDPNLDAAYAGKLKQACPRNFDPRTVVPLDPVTPSQFDNRYYSNLVNNMGLMISDQTLHSDMLTQFSSESNAEDENMWQFKFANAMVRMGAINVKAEGEIRKNCRLRN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCTCGTCGTCCGCAAAGCAGTAGCAGCATTGGTGGTGAGTGTTGTTGTCACGCTTGTCCGTGTGGAAGCTCAGCTCGTTGTTGGATACTACGAGCAAAATGGATGTCCCATGGCC
GAGGAGATTGTCAAGAAAGTTCTCACCGCGGCCGTGGCACGAGACCAATCCATCGCTGCTTCGTTGCTTCGTCTCCACTTCCACGACTGTTTCGTCCAG
GTCCGTGATCAACTTCTGTCT
CGCCTTTCATCTAGGCAGCATCGTTATCGATTTGAAAAATCCGTAGTCATTGAAAGAATTCTTGCTCACCAATCCTCGCCAACTTGATGAACAGGGCTGTGACGGGTCCGTTCTCTTGGA
TCCACAAAACGGCTTCCCCGCCACGGAGAAACAAGCTGTCCCAAACTTCTCGCTCCGGGGATACAACCTCGTCGACGCCATAAAGCAAGCTCTCGAACAAGCGTGTCCAGAGACTGTCTC
ATGTGCTGACATTCTCGCTATAGCAGCCCGAGATGCTGTTTCCCTG
GTAAGAACTTTCTGCTTCGTAAGATTTCTTTCGAGAACTTGACGAAGAATGCTTACCACCAGTCTGGAGGAGGA
ACTTGGCCAGTGGAAACAGGACGTAGAGATGGTGTTATTTCACTCAGGACCGAAGCGGAGAACCTTCTTCCTCCCACGAACGAAAACTCTGAAGTGTTAACCCAGAGGTTCCTTGATGTT
GGTCTGACTCAAGATGAGATGATCACCTTGTCCG
GTAAAGTTTCATAAGTTTGCTCTCGGCCTGCCACTGATCTTCTTCCAACTTCCAGGAGCACACACGATAGGACGAGCTCACTGTGT
CTCTTTCAGCCAGAGGCTCTATAACTTCAGCCCGGAGTTTGATACTGATCCGAATCTCGACGCTGCTTACGCCGGGAAACTAAAGCAGGCCTGTCCGAGGAACTTTGATCCGAGAACTGT
CGTGCCGCTGGATCCTGTCACCCCTTCCCAGTTTGACAATCGCTACTACTCCAACCTCGTCAACAACATGGGGCTCATGATCTCAGATCAGACGCTCCACAGCGACATGCTCACCCAGTT
TTCTTCCGAGTCAAACGCCGAGGATGAAAACATGTGGCAGTTCAAGTTCGCAAACGCCATGGTCCGGATGGGTGCTATTAACGTCAAGGCTGAAGGCGAGATTCGCAAAAACTGCCGACT
GAGGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCTCGTCGTCCGCAAAGCAGTAGCAGCATTGGTGGTGAGTGTTGTTGTCACGCTTGTCCGTGTGGAAGCTCAGCTCGTTGTTGGATACTACGAGCAAAATGGATGTCCCATGGCC
GAGGAGATTGTCAAGAAAGTTCTCACCGCGGCCGTGGCACGAGACCAATCCATCGCTGCTTCGTTGCTTCGTCTCCACTTCCACGACTGTTTCGTCCAG
GGCTGTGACGGGTCCGTTCTC
TTGGATCCACAAAACGGCTTCCCCGCCACGGAGAAACAAGCTGTCCCAAACTTCTCGCTCCGGGGATACAACCTCGTCGACGCCATAAAGCAAGCTCTCGAACAAGCGTGTCCAGAGACT
GTCTCATGTGCTGACATTCTCGCTATAGCAGCCCGAGATGCTGTTTCCCTG
TCTGGAGGAGGAACTTGGCCAGTGGAAACAGGACGTAGAGATGGTGTTATTTCACTCAGGACCGAAGCG
GAGAACCTTCTTCCTCCCACGAACGAAAACTCTGAAGTGTTAACCCAGAGGTTCCTTGATGTTGGTCTGACTCAAGATGAGATGATCACCTTGTCCG
GAGCACACACGATAGGACGAGCT
CACTGTGTCTCTTTCAGCCAGAGGCTCTATAACTTCAGCCCGGAGTTTGATACTGATCCGAATCTCGACGCTGCTTACGCCGGGAAACTAAAGCAGGCCTGTCCGAGGAACTTTGATCCG
AGAACTGTCGTGCCGCTGGATCCTGTCACCCCTTCCCAGTTTGACAATCGCTACTACTCCAACCTCGTCAACAACATGGGGCTCATGATCTCAGATCAGACGCTCCACAGCGACATGCTC
ACCCAGTTTTCTTCCGAGTCAAACGCCGAGGATGAAAACATGTGGCAGTTCAAGTTCGCAAACGCCATGGTCCGGATGGGTGCTATTAACGTCAAGGCTGAAGGCGAGATTCGCAAAAAC
TGCCGACTGAGGAACTAG

Retrieve as FASTA