Entry information : SmPrx51-2_1 (SmPrx51b_1)
Entry ID 7021
Creation 2009-10-19 (Christophe Dunand)
Last sequence changes 2009-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx51-2_1 (SmPrx51b_1)
Name (synonym) SmPrx51-2_1 (SmPrx51b_1)
Class Class III peroxidase    [Orthogroup: Prx284]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx51-2_1
start..stop
S start..stop
SmPrx51-1_16 704 0 1..350 1..350
WmPrx08 347 1e-119 31..347 19..333
CclPrx48 343 4e-118 43..347 27..319
CsPrx07 343 4e-118 43..347 27..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2329840..2330103 264 N° 2 2329580..2329771 192 N° 3 2328855..2329451 597  
complement(join(2328855..2329451,2329580..2329771,2329840..2330103))


exon

Literature and cross-references SmPrx51-2_1 (SmPrx51b_1)
DNA ref. Phytozome 12:   scaffold_1 (2330103..2328855)
mRNA ref. JGI transcript:   403410 [Incorrect splicing]
Protein sequence: SmPrx51-2_1 (SmPrx51b_1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (328)
PWM (Da):   %s   38229.08 (35976.8)  
PI (pH):   %s   4.97 (4.79) Peptide Signal:   %s   cut: 23 range:23-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLNLAIISLVFLGAVLGSRGQYEYDDDNVVAISENSTLYGLSEDFYRHACPQVYSIVRAGVEAAIKIQQRNAASLLRLFFHDCFVQGCDASLLLDDAPFFIGEKTAAANNQSARGFEFIDVIKASVEEACPLTVSCADILAIVARDAVVLSGGPNWEVALGRRDGLTASRAASDHFIPDPTYDLPQLLSSFQAMGLSAEDLVSLVGAHTMGFSRCTSFEQRIYNQSGTHHPDVNIEPGFLKQLHDRCPPHGDPNTLQPLDRESPASFDNDYYKNLVSQSAVLHSDGTLYSEAIAGFAGIRELVEKFAEDEQAFFASFARSIVRMGNLRPLIGDKGEVRKNCRRVNHKF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Incorrect prediction from JGI (=> extra 3' intron). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGGCTCAATTTGGCTATCATCTCGCTGGTGTTCTTGGGTGCCGTACTGGGATCAAGAGGGCAGTACGAGTACGACGATGACAACGTTGTTGCCATTAGCGAGAACAGTACGCTG
TACGGACTGAGCGAGGATTTCTATAGGCACGCTTGTCCCCAGGTCTACTCCATCGTCAGGGCTGGAGTGGAGGCCGCGATTAAGATCCAGCAGCGCAATGCGGCATCGCTGCTACGCCTC
TTCTTCCACGACTGCTTCGTCCAA
GTAAAGCTCTCTTAACCCTGGATTGATCGATAGAACGATCGCTGCTCAATGCTTTTCTTTACTTCCAGGGATGCGATGCGTCGCTGCTCCTCGATG
ACGCGCCCTTCTTCATCGGCGAGAAAACTGCCGCCGCCAACAATCAATCGGCTCGAGGATTCGAGTTCATCGACGTGATCAAAGCGAGCGTCGAGGAAGCGTGCCCTCTCACCGTCTCCT
GCGCTGATATTCTCGCCATCGTGGCCAGGGACGCCGTTGTCTTG
GTAAGCATGTGAACTTCCCCTCTTTTTTCCTCCTATTTCCCTCTTGTCACCCCCGCATTGCCTTTTTTCCCTCTGT
TTCCCTCGTGTTTTCCCAGAATTTCTGACGCACGGCGCTATGACATGGACAGAGTGGAGGACCCAACTGGGAAGTGGCGCTCGGGCGGAGGGACGGCCTCACGGCGAGCCGAGCAGCGTC
GGATCATTTCATCCCGGATCCCACGTACGATCTCCCCCAACTTCTCTCATCCTTCCAGGCGATGGGCCTGAGCGCCGAGGATCTAGTCTCGCTCGTCGGAGCTCACACAATGGGCTTCTC
GCGATGTACGAGCTTTGAGCAGCGGATCTACAACCAGAGCGGAACCCACCACCCGGATGTTAACATCGAGCCCGGGTTTCTCAAGCAGCTCCACGATCGATGCCCGCCCCACGGCGATCC
AAACACGCTCCAGCCCCTCGACCGGGAGTCCCCGGCCTCATTCGACAATGACTACTACAAGAACTTGGTGTCCCAAAGCGCGGTGCTCCACTCGGACGGGACGCTCTACTCGGAGGCGAT
CGCGGGGTTTGCAGGGATTCGCGAGCTCGTGGAGAAGTTTGCCGAGGACGAGCAGGCATTCTTCGCGAGCTTTGCGAGATCGATCGTGAGAATGGGGAACTTGAGGCCGCTGATCGGGGA
CAAGGGCGAGGTGAGAAAGAACTGCCGGAGAGTGAACCACAAGTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGGCTCAATTTGGCTATCATCTCGCTGGTGTTCTTGGGTGCCGTACTGGGATCAAGAGGGCAGTACGAGTACGACGATGACAACGTTGTTGCCATTAGCGAGAACAGTACGCTG
TACGGACTGAGCGAGGATTTCTATAGGCACGCTTGTCCCCAGGTCTACTCCATCGTCAGGGCTGGAGTGGAGGCCGCGATTAAGATCCAGCAGCGCAATGCGGCATCGCTGCTACGCCTC
TTCTTCCACGACTGCTTCGTCCAA
GGATGCGATGCGTCGCTGCTCCTCGATGACGCGCCCTTCTTCATCGGCGAGAAAACTGCCGCCGCCAACAATCAATCGGCTCGAGGATTCGAGTTC
ATCGACGTGATCAAAGCGAGCGTCGAGGAAGCGTGCCCTCTCACCGTCTCCTGCGCTGATATTCTCGCCATCGTGGCCAGGGACGCCGTTGTCTTG
AGTGGAGGACCCAACTGGGAAGTG
GCGCTCGGGCGGAGGGACGGCCTCACGGCGAGCCGAGCAGCGTCGGATCATTTCATCCCGGATCCCACGTACGATCTCCCCCAACTTCTCTCATCCTTCCAGGCGATGGGCCTGAGCGCC
GAGGATCTAGTCTCGCTCGTCGGAGCTCACACAATGGGCTTCTCGCGATGTACGAGCTTTGAGCAGCGGATCTACAACCAGAGCGGAACCCACCACCCGGATGTTAACATCGAGCCCGGG
TTTCTCAAGCAGCTCCACGATCGATGCCCGCCCCACGGCGATCCAAACACGCTCCAGCCCCTCGACCGGGAGTCCCCGGCCTCATTCGACAATGACTACTACAAGAACTTGGTGTCCCAA
AGCGCGGTGCTCCACTCGGACGGGACGCTCTACTCGGAGGCGATCGCGGGGTTTGCAGGGATTCGCGAGCTCGTGGAGAAGTTTGCCGAGGACGAGCAGGCATTCTTCGCGAGCTTTGCG
AGATCGATCGTGAGAATGGGGAACTTGAGGCCGCTGATCGGGGACAAGGGCGAGGTGAGAAAGAACTGCCGGAGAGTGAACCACAAGTTCTAA

Retrieve as FASTA