Entry information : SmPrx57-2_33 (SmPrx57b_33)
Entry ID 7023
Creation 2009-10-08 (Paula Nunes)
Last sequence changes 2009-10-08 (Paula Nunes)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx57-2_33 (SmPrx57b_33)
Name (synonym) SmPrx57-2_33 (SmPrx57b_33)
Class Class III peroxidase    [Orthogroup: Prx350]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx57-2_33
start..stop
S start..stop
SmPrx57-1_5 664 0 1..330 1..330
SmPrx80-1_13 377 1.36e-131 17..329 18..327
SmPrx80-2_66 374 1.66e-130 22..329 16..321
PabPrx102 347 7.16e-120 27..329 23..325
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7023' 'complement(join(574141..574553,574612..574777,574850..575044,575117..575335))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 575117..575335 217 N° 2 574850..575044 193 N° 3 574612..574777 164 N° 4 574141..574553 411
complement(join(574141..574553,574612..574777,574850..575044,575117..575335))


exon

Literature and cross-references SmPrx57-2_33 (SmPrx57b_33)
DNA ref. Phytozome 12:   scaffold_33 (575335..574141)
mRNA ref. JGI transcript:   268057
Protein sequence: SmPrx57-2_33 (SmPrx57b_33)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (311)
PWM (Da):   %s   35896.29 (33874.1)  
PI (pH):   %s   5.48 (5.26) Peptide Signal:   %s   cut: 20 range:20-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPVREILVMVSLLKASLAVFSAAADKLELGYYSETCPNLEEILA
TSAKLKLAEAPTTPAAVVRLLFHDCFIE
GCDASIMITSTPDNLAERDAEVNRDLAGDGFDAVVRAKAAVEAECPGVVSCADILVIIARNFIELTGGPSYPVLKGRKDGFISEAARVQDNLPGSTLNLHQLLRNFKSKGLDMEDLVVLSGAHTFGFAHCKQFHKRLYNFSRDRAMDPRLPPVFASSLKAACPERGDDPGLVLPFDPSTPFAFDNSYYKTLVAGNALLISDETLLAKRKTREMIREFARDEQKFYQEFGAAMQRLSSVGV
KVGSDGDVRRDCTAFNR

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCAGTGCGTGAGATTTTGGTAATGGTTTCCTTGTTGAAGGCTTCGTTGGCGGTTTTTAGTGCAGCAGCAGATAAACTCGAGCTCGGCTATTACTCCGAGACTTGTCCAAATTTG
GAAGAGATCCTCGCAACCTCTGCTAAACTTAAGCTGGCCGAAGCACCCACGACTCCTGCGGCTGTTGTGAGGCTCTTGTTCCACGACTGCTTCATTGAG
GTAAGTCCGATTTTCTCGTTT
CTCTGCTTGTGTTTTTTTCGATCTTGTGATGATCTTGTTTGCATGGTGCAGGGGGATGCGATGCCTCGATCATGATAACTTCTACTCCGGACAACTTGGCTGAAAGAGACGCGGAAGTTA
ACAGGGACTTGGCTGGTGATGGTTTTGATGCCGTGGTTCGAGCAAAGGCGGCGGTGGAAGCCGAGTGCCCGGGAGTGGTGTCTTGTGCTGACATCTTGGTGATCATAGCGAGAAACTTCA
TAGAGCTG
GTAAGATAAGTTTCAATAGTTCTCATGCAATTCTAGCTTCCAGGTTGATCAAAAGGTCTTTTTGATTGACAGACACTGGTGGGCCTTCGTATCCTGTTCTCAAGGGAAGAAA
AGATGGATTTATCTCCGAGGCCGCGAGGGTCCAGGACAACCTTCCAGGCTCCACCTTGAATCTCCATCAACTTTTACGCAACTTCAAGAGCAAAGGACTGGACATGGAAGATCTCGTGGT
ACTGAGTG
GTAAGCTCTCAAAGCTTTTCATCTAAAAGCTCGAAAAGTTTCATGGATTCCTCCCTAGGTGTGCTCACACTTTTGGATTCGCTCACTGCAAGCAATTCCACAAGAGGCTCTA
CAACTTTAGCCGCGATCGCGCAATGGATCCGAGACTCCCTCCGGTTTTCGCGTCGAGCCTCAAGGCCGCCTGTCCCGAGCGTGGCGATGATCCAGGCTTGGTGCTGCCCTTCGATCCCTC
CACTCCATTCGCCTTCGACAACTCCTACTACAAGACCCTCGTCGCTGGAAACGCGCTGCTCATCTCGGACGAGACGCTCCTCGCCAAGCGCAAGACGAGGGAGATGATCAGGGAATTCGC
GAGAGACGAGCAAAAGTTCTACCAGGAATTTGGCGCCGCGATGCAAAGGCTGTCGAGCGTTGGAGTGAAGGTTGGGAGCGATGGCGATGTGAGGAGAGACTGCACGGCGTTTAATCGGTA
G

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCAGTGCGTGAGATTTTGGTAATGGTTTCCTTGTTGAAGGCTTCGTTGGCGGTTTTTAGTGCAGCAGCAGATAAACTCGAGCTCGGCTATTACTCCGAGACTTGTCCAAATTTG
GAAGAGATCCTCGCAACCTCTGCTAAACTTAAGCTGGCCGAAGCACCCACGACTCCTGCGGCTGTTGTGAGGCTCTTGTTCCACGACTGCTTCATTGAG
GGATGCGATGCCTCGATCATG
ATAACTTCTACTCCGGACAACTTGGCTGAAAGAGACGCGGAAGTTAACAGGGACTTGGCTGGTGATGGTTTTGATGCCGTGGTTCGAGCAAAGGCGGCGGTGGAAGCCGAGTGCCCGGGA
GTGGTGTCTTGTGCTGACATCTTGGTGATCATAGCGAGAAACTTCATAGAGCTG
ACTGGTGGGCCTTCGTATCCTGTTCTCAAGGGAAGAAAAGATGGATTTATCTCCGAGGCCGCGAGG
GTCCAGGACAACCTTCCAGGCTCCACCTTGAATCTCCATCAACTTTTACGCAACTTCAAGAGCAAAGGACTGGACATGGAAGATCTCGTGGTACTGAGTG
GTGCTCACACTTTTGGATTC
GCTCACTGCAAGCAATTCCACAAGAGGCTCTACAACTTTAGCCGCGATCGCGCAATGGATCCGAGACTCCCTCCGGTTTTCGCGTCGAGCCTCAAGGCCGCCTGTCCCGAGCGTGGCGAT
GATCCAGGCTTGGTGCTGCCCTTCGATCCCTCCACTCCATTCGCCTTCGACAACTCCTACTACAAGACCCTCGTCGCTGGAAACGCGCTGCTCATCTCGGACGAGACGCTCCTCGCCAAG
CGCAAGACGAGGGAGATGATCAGGGAATTCGCGAGAGACGAGCAAAAGTTCTACCAGGAATTTGGCGCCGCGATGCAAAGGCTGTCGAGCGTTGGAGTGAAGGTTGGGAGCGATGGCGAT
GTGAGGAGAGACTGCACGGCGTTTAATCGGTAG

Retrieve as FASTA