Entry information : SmPrx56-2_33 (SmPrx56b_33)
Entry ID 7024
Creation 2009-10-08 (Paula Nunes)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Toky Ramarohetra
Last annotation changes 2011-01-26 (Toky Ramarohetra)
Peroxidase information: SmPrx56-2_33 (SmPrx56b_33)
Name (synonym) SmPrx56-2_33 (SmPrx56b_33)
Class Class III peroxidase    [Orthogroup: Prx281]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx56-2_33
start..stop
S start..stop
SmPrx56-1_5 692 0 1..336 1..336
GbPrx04 390 1.35e-136 13..336 7..329
SmPrx106-1_173 386 8.3e-135 40..333 58..352
SmPrx106-2_43 385 2.84e-134 40..333 62..356
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7024' 'complement(join(450411..450820,450895..451060,451121..451312,451416..451658))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 451416..451658 241 N° 2 451121..451312 190 N° 3 450895..451060 164 N° 4 450411..450820 408
complement(join(450411..450820,450895..451060,451121..451312,451416..451658))


exon

Literature and cross-references SmPrx56-2_33 (SmPrx56b_33)
DNA ref. Phytozome 12:   scaffold_33 (451658..450411)
mRNA ref. JGI transcript:   417074
Protein sequence: SmPrx56-2_33 (SmPrx56b_33)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (311)
PWM (Da):   %s   36807.53 (34252.1)  
PI (pH):   %s   6.73 (7.63) Peptide Signal:   %s   cut: 30 range:26-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDSPLGDANTTLILLALVFLSSIVADVSCSSDDPSLSAFFYDYTC
PQLQDIVRSDVEKAFKREARIAASLLRLHFHDCFIN
GCDASVLLDDTKTFKGEKSALPNANSLRGFELIDAIKARVEIQCEGVVSCADILTLAARDSVALTGGPSWEVLLGRRDSLTANRTAANVLIPPPIADVPKLVSMFATMGLTEVDMVTLSG
AHSIGQARCSTFRQRLFDDRGSGSPDPTMQKQFLGSLQEICPRQGNGNAVAPLDFVTPMRFDNNYYLNLQYGKGIFASDQVLFSGRGITENYVRYYSYDQDAFFQSFVRSMIKMGNITPL
TGKRGQIRKNCRRPN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATTCTCCTCTGGGAGATGCGAACACCACCTTGATCTTGCTCGCGCTCGTGTTCTTGAGCTCCATTGTCGCGGACGTGAGTTGTAGCAGCGATGATCCGTCGCTGAGCGCTTTCTTC
TACGATTATACGTGCCCCCAGCTCCAGGACATCGTTCGATCGGACGTGGAGAAGGCTTTCAAGCGCGAGGCACGGATCGCGGCGTCGCTCCTCCGCCTCCATTTCCACGACTGCTTCATC
AAT
GTGAGTAAGCAATCCAAAACTCTGAAAGCTTTAAGTAGTACCTTAGTGTTCTCCCAAGTTTCTCGGGCGAAAGAGAAGAAAAAAAAACGATTTTTTTCCGCAGGGGGATGCGATGCC
TCGGTGCTGCTGGACGACACCAAGACCTTCAAAGGCGAGAAATCTGCGCTGCCCAACGCGAACTCTCTCCGTGGATTCGAACTCATCGACGCGATCAAGGCCAGAGTGGAGATCCAGTGC
GAAGGAGTCGTCTCCTGTGCTGATATCTTGACGCTCGCTGCTCGAGACTCAGTCGCACTG
GTACGTAGCAGCAAAAAAATCCCTCCTTTCTGATCGATCGATCGGTCCAACTCTTATCAG
ACACCGGAGGACCATCGTGGGAAGTGCTGCTCGGGCGGAGGGACAGCCTCACTGCCAACAGAACCGCGGCCAACGTTCTCATCCCACCCCCTATAGCCGACGTTCCAAAGCTCGTCTCAA
TGTTCGCCACAATGGGGCTCACCGAGGTAGACATGGTAACACTTTCAG
GTACGTAATCCAATCCCCACCGTCCATCGGCCCGCCCATTCTGACCCGGAATGTCCACTGTTCTTGGCGCCA
AGGCGCGCCCACAGCATCGGCCAGGCGCGATGCTCCACCTTCCGCCAGCGATTATTCGACGATCGCGGCAGCGGCAGCCCCGATCCGACCATGCAGAAGCAGTTCCTGGGCTCGCTGCAA
GAGATTTGCCCCCGGCAGGGCAACGGCAACGCGGTGGCGCCGCTGGATTTCGTGACGCCCATGCGATTTGACAACAATTACTACCTCAATCTCCAGTATGGCAAGGGGATCTTCGCGTCG
GACCAGGTGCTCTTCAGCGGGCGCGGGATCACGGAGAACTACGTGCGCTACTACAGCTACGATCAAGACGCATTCTTCCAGAGCTTCGTGCGATCCATGATAAAAATGGGCAACATCACG
CCGCTCACAGGGAAGAGAGGCCAGATTCGAAAGAACTGCCGAAGACCTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATTCTCCTCTGGGAGATGCGAACACCACCTTGATCTTGCTCGCGCTCGTGTTCTTGAGCTCCATTGTCGCGGACGTGAGTTGTAGCAGCGATGATCCGTCGCTGAGCGCTTTCTTC
TACGATTATACGTGCCCCCAGCTCCAGGACATCGTTCGATCGGACGTGGAGAAGGCTTTCAAGCGCGAGGCACGGATCGCGGCGTCGCTCCTCCGCCTCCATTTCCACGACTGCTTCATC
AAT
GGATGCGATGCCTCGGTGCTGCTGGACGACACCAAGACCTTCAAAGGCGAGAAATCTGCGCTGCCCAACGCGAACTCTCTCCGTGGATTCGAACTCATCGACGCGATCAAGGCCAGA
GTGGAGATCCAGTGCGAAGGAGTCGTCTCCTGTGCTGATATCTTGACGCTCGCTGCTCGAGACTCAGTCGCACTG
ACCGGAGGACCATCGTGGGAAGTGCTGCTCGGGCGGAGGGACAGC
CTCACTGCCAACAGAACCGCGGCCAACGTTCTCATCCCACCCCCTATAGCCGACGTTCCAAAGCTCGTCTCAATGTTCGCCACAATGGGGCTCACCGAGGTAGACATGGTAACACTTTCA
G
GCGCCCACAGCATCGGCCAGGCGCGATGCTCCACCTTCCGCCAGCGATTATTCGACGATCGCGGCAGCGGCAGCCCCGATCCGACCATGCAGAAGCAGTTCCTGGGCTCGCTGCAAGAG
ATTTGCCCCCGGCAGGGCAACGGCAACGCGGTGGCGCCGCTGGATTTCGTGACGCCCATGCGATTTGACAACAATTACTACCTCAATCTCCAGTATGGCAAGGGGATCTTCGCGTCGGAC
CAGGTGCTCTTCAGCGGGCGCGGGATCACGGAGAACTACGTGCGCTACTACAGCTACGATCAAGACGCATTCTTCCAGAGCTTCGTGCGATCCATGATAAAAATGGGCAACATCACGCCG
CTCACAGGGAAGAGAGGCCAGATTCGAAAGAACTGCCGAAGACCTAATTAG

Retrieve as FASTA