Entry information : SmPrx32-1_84 (SmPrx32a_84)
Entry ID 7029
Creation 2009-10-12 (Paula Nunes)
Last sequence changes 2009-10-12 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx32-1_84 (SmPrx32a_84)
Name (synonym) SmPrx32-1_84 (SmPrx32a_84)
Class Class III peroxidase    [Orthogroup: Prx229]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx32-1_84
start..stop
S start..stop
SmPrx32-2_131 603 0 1..324 1..324
SmPrx106-2_43 373 8e-130 23..320 58..356
SmPrx106-1_173 371 4e-129 23..320 54..352
GbPrx04 368 3e-128 8..323 7..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 177059..177262 204 N° 2 176792..176983 192 N° 3 176577..176742 166 N° 4 176106..176518 413
complement(join(176106..176518,176577..176742,176792..176983,177059..177262))


exon

Literature and cross-references SmPrx32-1_84 (SmPrx32a_84)
DNA ref. Phytozome 12:   scaffold_84 (177262..176106)
mRNA ref. JGI transcript:   235372
EST ref. GenBank:   FE450990.1 [3' end]   FE507058.1 [3' end]
Protein sequence: SmPrx32-1_84 (SmPrx32a_84)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (303)
PWM (Da):   %s   34406.08 (32127.8)  
PI (pH):   %s   4.59 (4.76) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEFVCLVVALLLSLVFSLVDSQLTTSFYDQSCPQVFSIVRQGVDRAFSREQRLAASLLRLHFHDCFVNGCDASILLDDTSTFTGEKTAGPNLNSARGFDVIDDIKSELENQCPGIVSCADILALAARDSVTVSAGPSWDVLLGRRDSFRASQADANRFIPSPASDVPALVSAFQAVGLSASNMIVLSGAHTIGAARCGTLTPRLYNQSGTGQPDSVGDPDFLASLQRLCPPGGNPGTLSRLDVRSPQAFDNSYYQNLLQGRGVLHSDQILFSGGGSSAQAVQDLSSDENLFFGNFAASMVRLGSIAPLTFPDGEIRTNCRFTNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 2 ESTs
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTTTGTCTGCCTTGTGGTGGCTCTACTGCTATCTCTTGTTTTCTCTTTGGTTGATTCTCAGCTCACCACCAGCTTCTACGATCAAAGTTGTCCGCAGGTCTTCTCCATCGTGAGG
CAAGGCGTGGATCGAGCGTTTTCGAGAGAGCAGCGCCTCGCAGCATCATTACTGCGCCTACACTTTCACGACTGCTTTGTCAAC
GTTGGATCACGAGTTCCACACTTGAAACTCGGCACG
GGTTAAGTCACTGTTCTCATCTCAGTTGCTCATGTGCAGGGCTGCGATGCTTCGATTCTCCTGGACGACACTTCCACCTTCACTGGAGAGAAGACAGCCGGTCCAAACCTCAACTCGGCG
AGAGGCTTCGATGTTATCGACGATATCAAGTCGGAGCTCGAGAATCAGTGTCCAGGCATTGTCTCGTGCGCTGACATTCTAGCTCTCGCTGCCAGGGACTCCGTCACTGTG
GTAAAGTTC
ATACGAACGTAGTCGCTATCGATCAACTTTGTTCTTTCAGTCCGCTGGACCATCGTGGGATGTTCTTCTGGGCCGCCGAGATAGTTTTCGAGCTAGCCAAGCCGATGCCAATCGCTTCAT
TCCATCGCCCGCGTCGGACGTTCCAGCGTTGGTCTCGGCATTTCAAGCAGTGGGTCTCTCAGCATCGAACATGATAGTTCTTTCAG
GTACTGCCAGCCAACTTCGATTCTCCCACGCAAA
AAAATGGATTTTTCTCGTTTCTAGGTGCTCATACTATTGGAGCTGCTCGCTGCGGCACCCTGACTCCACGTCTCTACAACCAAAGTGGCACCGGACAGCCCGACTCCGTCGGCGATCCCG
ATTTTCTGGCCTCGCTCCAGCGCTTGTGTCCACCGGGTGGCAATCCGGGGACTCTCTCCCGCCTCGACGTGAGATCTCCGCAGGCATTCGACAACTCCTACTACCAGAATTTGCTGCAAG
GCCGCGGAGTGCTCCACTCGGATCAAATCCTCTTCTCCGGCGGTGGCTCGTCGGCACAGGCAGTCCAAGACTTGAGCAGCGATGAAAATCTCTTCTTTGGGAACTTTGCGGCGTCCATGG
TGAGACTGGGGAGCATCGCTCCTCTCACTTTCCCGGATGGAGAGATTAGAACGAACTGCCGCTTTACAAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTTTGTCTGCCTTGTGGTGGCTCTACTGCTATCTCTTGTTTTCTCTTTGGTTGATTCTCAGCTCACCACCAGCTTCTACGATCAAAGTTGTCCGCAGGTCTTCTCCATCGTGAGG
CAAGGCGTGGATCGAGCGTTTTCGAGAGAGCAGCGCCTCGCAGCATCATTACTGCGCCTACACTTTCACGACTGCTTTGTCAAC
GGCTGCGATGCTTCGATTCTCCTGGACGACACTTCC
ACCTTCACTGGAGAGAAGACAGCCGGTCCAAACCTCAACTCGGCGAGAGGCTTCGATGTTATCGACGATATCAAGTCGGAGCTCGAGAATCAGTGTCCAGGCATTGTCTCGTGCGCTGAC
ATTCTAGCTCTCGCTGCCAGGGACTCCGTCACTGTG
TCCGCTGGACCATCGTGGGATGTTCTTCTGGGCCGCCGAGATAGTTTTCGAGCTAGCCAAGCCGATGCCAATCGCTTCATTCCA
TCGCCCGCGTCGGACGTTCCAGCGTTGGTCTCGGCATTTCAAGCAGTGGGTCTCTCAGCATCGAACATGATAGTTCTTTCAG
GTGCTCATACTATTGGAGCTGCTCGCTGCGGCACCCTG
ACTCCACGTCTCTACAACCAAAGTGGCACCGGACAGCCCGACTCCGTCGGCGATCCCGATTTTCTGGCCTCGCTCCAGCGCTTGTGTCCACCGGGTGGCAATCCGGGGACTCTCTCCCGC
CTCGACGTGAGATCTCCGCAGGCATTCGACAACTCCTACTACCAGAATTTGCTGCAAGGCCGCGGAGTGCTCCACTCGGATCAAATCCTCTTCTCCGGCGGTGGCTCGTCGGCACAGGCA
GTCCAAGACTTGAGCAGCGATGAAAATCTCTTCTTTGGGAACTTTGCGGCGTCCATGGTGAGACTGGGGAGCATCGCTCCTCTCACTTTCCCGGATGGAGAGATTAGAACGAACTGCCGC
TTTACAAACTCTTGA

Retrieve as FASTA