Entry information : SmPrx33-1_84 (SmPrx33a_84)
Entry ID 7030
Creation 2009-10-12 (Paula Nunes)
Last sequence changes 2009-10-12 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-02-01 (Christophe Dunand)
Peroxidase information: SmPrx33-1_84 (SmPrx33a_84)
Name (synonym) SmPrx33-1_84 (SmPrx33a_84)
Class Class III peroxidase    [Orthogroup: Prx347]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx33-1_84
start..stop
S start..stop
SmPrx33-2_131 705 0 1..345 1..345
CmichPrx01 396 1.9e-138 42..342 60..361
SmPrx37-2_44 375 2.88e-130 46..342 45..342
SmPrx37-1_2 374 3.81e-130 46..342 43..340
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7030' 'complement(join(149705..150289,150347..150538,150610..150870))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150610..150870 259 N° 2 150347..150538 190 N° 3 149705..150289 583  
complement(join(149705..150289,150347..150538,150610..150870))


exon

Literature and cross-references SmPrx33-1_84 (SmPrx33a_84)
DNA ref. Phytozome 12:   scaffold_84 (150870..149705)
mRNA ref. JGI transcript:   138810 [Incorrect splicing]  235371 [Incorrect splicing]
EST ref. GenBank:   FE447752.1 [3' end]
Protein sequence: SmPrx33-1_84 (SmPrx33a_84)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345
PWM (Da):   %s   37267.25  
PI (pH):   %s   8.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIPRPGVGGFPFPAGRGFPFPGGRPFPFPGGATSAEMGIAVLRPGFYKEKCPAAESIVKEVLQQAVEKDSRTAANILRLQFHDCFVLGCDASILLDDTHTFKGEKTANPNRNSARGFEVI
DEIKAALEKECEGVVSCADVLAIAARDSVVL
TGGPSWEVHLGRRDSLTASRSLANRDIPPPNSTLPQLIAAFAKKGLSIVDLVALTGSHTIGVSRCASFRQRLYNFAGTRRPDPSIDPAL
LRSLEHICPPKGNAQETTPLDIVTPTKFDNHFFVDLELHKGVLTSDQVLFAPYAPTSALVTAFAYDQAKFFQEFVASMVRMAAIKPLLGSEGQIRKECRFVNHKY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 1 EST. Incorrect transcript from JGI. Also found in scaffold_369 (100% at DNA level)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCGAGGCCTGGCGTGGGAGGCTTTCCATTCCCAGCAGGACGGGGTTTTCCATTCCCAGGAGGACGACCATTTCCATTTCCCGGTGGTGCTACTTCTGCGGAGATGGGAATTGCT
GTGTTGCGGCCTGGCTTCTACAAGGAGAAGTGCCCCGCTGCCGAGTCTATCGTGAAGGAAGTCTTGCAGCAGGCCGTGGAAAAGGATTCCAGAACTGCTGCAAACATTCTCAGGCTTCAG
TTTCACGATTGTTTCGTTCTG
GTAAGTTGTTGCATTCTTTTTTCTTTGTTTTTCTTTGTTTTTTATGAGAATAAGATGTGAATTTCTTGCAGGGGGATGTGATGCTTCCATACTTCTGGA
CGATACGCATACTTTCAAAGGAGAAAAGACCGCCAATCCCAACAGGAACTCGGCTCGTGGCTTCGAAGTCATTGACGAGATCAAGGCAGCTCTGGAGAAGGAATGCGAGGGTGTTGTTTC
TTGTGCCGACGTTCTCGCCATTGCTGCACGGGACTCGGTCGTCCTG
GTACGTACTTCGATACTAATCTTTGATCTCACTTCTTTTCTGTGTGGCATGAATCAGACACTGGAGGCCCGTCG
TGGGAAGTTCATCTTGGTCGTCGAGACAGCCTGACTGCGAGCCGCAGCCTGGCCAACAGAGACATCCCGCCTCCCAACTCGACGCTTCCGCAGCTCATCGCCGCATTTGCCAAGAAGGGC
CTGTCCATCGTGGACTTGGTGGCACTGACGGGCTCTCACACCATTGGCGTGTCACGCTGCGCCAGCTTCCGGCAGCGCCTCTACAACTTTGCGGGAACTCGTCGGCCAGATCCGAGCATC
GACCCGGCGCTCCTCCGCAGCCTCGAGCACATTTGTCCTCCCAAAGGCAACGCGCAGGAGACGACGCCTCTGGACATCGTCACTCCCACCAAGTTTGACAATCACTTCTTCGTCGATCTG
GAGCTTCACAAGGGTGTTCTTACGTCGGACCAGGTGCTGTTTGCGCCGTATGCTCCCACCAGCGCACTGGTTACGGCATTTGCCTACGACCAGGCAAAGTTCTTCCAGGAGTTTGTAGCG
TCCATGGTGAGGATGGCTGCCATCAAGCCGCTGCTGGGATCGGAGGGCCAGATCAGGAAGGAGTGCCGGTTCGTCAATCACAAGTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCGAGGCCTGGCGTGGGAGGCTTTCCATTCCCAGCAGGACGGGGTTTTCCATTCCCAGGAGGACGACCATTTCCATTTCCCGGTGGTGCTACTTCTGCGGAGATGGGAATTGCT
GTGTTGCGGCCTGGCTTCTACAAGGAGAAGTGCCCCGCTGCCGAGTCTATCGTGAAGGAAGTCTTGCAGCAGGCCGTGGAAAAGGATTCCAGAACTGCTGCAAACATTCTCAGGCTTCAG
TTTCACGATTGTTTCGTTCTG
GGATGTGATGCTTCCATACTTCTGGACGATACGCATACTTTCAAAGGAGAAAAGACCGCCAATCCCAACAGGAACTCGGCTCGTGGCTTCGAAGTCATT
GACGAGATCAAGGCAGCTCTGGAGAAGGAATGCGAGGGTGTTGTTTCTTGTGCCGACGTTCTCGCCATTGCTGCACGGGACTCGGTCGTCCTG
ACTGGAGGCCCGTCGTGGGAAGTTCAT
CTTGGTCGTCGAGACAGCCTGACTGCGAGCCGCAGCCTGGCCAACAGAGACATCCCGCCTCCCAACTCGACGCTTCCGCAGCTCATCGCCGCATTTGCCAAGAAGGGCCTGTCCATCGTG
GACTTGGTGGCACTGACGGGCTCTCACACCATTGGCGTGTCACGCTGCGCCAGCTTCCGGCAGCGCCTCTACAACTTTGCGGGAACTCGTCGGCCAGATCCGAGCATCGACCCGGCGCTC
CTCCGCAGCCTCGAGCACATTTGTCCTCCCAAAGGCAACGCGCAGGAGACGACGCCTCTGGACATCGTCACTCCCACCAAGTTTGACAATCACTTCTTCGTCGATCTGGAGCTTCACAAG
GGTGTTCTTACGTCGGACCAGGTGCTGTTTGCGCCGTATGCTCCCACCAGCGCACTGGTTACGGCATTTGCCTACGACCAGGCAAAGTTCTTCCAGGAGTTTGTAGCGTCCATGGTGAGG
ATGGCTGCCATCAAGCCGCTGCTGGGATCGGAGGGCCAGATCAGGAAGGAGTGCCGGTTCGTCAATCACAAGTACTGA

Retrieve as FASTA