1. Browse the Database
  2. View Redoxidase
Entry information : SmPrx31-2_131 (SmPrx31b_131)
Entry ID 7032
Creation 2009-10-12 (Paula Nunes)
Last sequence changes 2009-10-12 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx31-2_131 (SmPrx31b_131)
Name (synonym) SmPrx31-2_131 (SmPrx31b_131)
Class Class III peroxidase    [Orthogroup: Prx346]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx31-2_131
start..stop		 S start..stop
SmPrx31-1_84 659 0 1..323 1..323
SmPrx74-2_39 370 4.29e-129 7..322 15..329
SmPrx50-1_126 368 3.6e-128 7..322 6..327
SmPrx74-1_88 367 8.38e-128 7..322 15..329
Gene structure Fichier Exons►


exon

Literature and cross-references SmPrx31-2_131 (SmPrx31b_131)
DNA ref. Phytozome 12:   scaffold_131 (237614..236585)
mRNA ref. JGI transcript:   135052
Protein sequence: SmPrx31-2_131 (SmPrx31b_131)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (304)
PWM (Da):   %s   34819.44 (32783.3)  
PI (pH):   %s   8.21 (8.21) Peptide Signal:   %s   cut: 20 range:20-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAFFHLHLLLSALSLVTAQQLSANFYDKSCPGLPSLATSVVSSA
VAKEPRMAASLLRLHFHDCFVNGCDASLLLDDTSSITSEKNALPNRRSVRGFEVIDDIKSKVEQQCKGVVSCADI
VSLAAREAVVLSGGPTWTVVYGRRDSTSASMDTANQDLPSFFDNATRLVARFKAKGLSARDMVALSGGHTIGHAQCVFFRDRLYNFSGSGSSDPILQQHYVTELKQQCPSATHDRSISAF
DPTTPAGFDNIYFKLLQVNKGLFRSDQVLYSTPGDTQDAVNAYSSSKAAFFKDFADAMVKMGNLSPLTGSKGQIRANCRLVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 2). No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST