Entry information : SmPrx32-2_131 (SmPrx32b_131)
Entry ID 7033
Creation 2009-10-12 (Paula Nunes)
Last sequence changes 2009-10-12 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx32-2_131 (SmPrx32b_131)
Name (synonym) SmPrx32-2_131 (SmPrx32b_131)
Class Class III peroxidase    [Orthogroup: Prx229]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx32-2_131
start..stop
S start..stop
SmPrx32-1_84 603 0 1..324 1..324
SmPrx106-2_43 376 8e-131 23..320 58..356
SmPrx106-1_173 374 4e-130 23..320 54..352
GbPrx04 370 4e-129 8..323 7..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 383451..383654 204 N° 2 383184..383375 192 N° 3 382969..383134 166 N° 4 382497..382909 413
complement(join(382497..382909,382969..383134,383184..383375,383451..383654))


exon

Literature and cross-references SmPrx32-2_131 (SmPrx32b_131)
DNA ref. Phytozome 12:   scaffold_131 (383654..382497)
mRNA ref. JGI transcript:   3562 [Incorrect splicing]
Protein sequence: SmPrx32-2_131 (SmPrx32b_131)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (303)
PWM (Da):   %s   34406.13 (32078.8)  
PI (pH):   %s   4.47 (4.59) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEFVWLVVALLLSLVISLVDSQLTTSFYDQSCPQVFSIVRQGVDRAFSREQRLAASLLRLHFHDCFVNGCDASILLDDTSTFTGEKAAGPNLNSARGFDVIDDIKSELENQCPGIVSCADILALVARDSVAVSAGPSWDVLLGRRDSFRASQADANRFIPSPASDVPALVSAFQAVGLSASDMIVLSGAHTIGAARCGTLTPRLYNQSGTGQPDSIGDPDFLASLQRLCPPGGNPGTLSRLDVRSPQEFDNSYYQNLLQGRGVLHSDQILFSGGGSSAQAVQDLSSDENLFFGNFAASMVRLGSIAPLTGPDGEIRTNCRFTNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Incorrect prediction from JGI
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTTTGTCTGGCTTGTGGTGGCTCTACTGCTATCTCTTGTTATCTCTTTGGTTGATTCTCAGCTCACCACCAGCTTCTACGATCAAAGTTGTCCGCAGGTCTTCTCCATCGTGAGG
CAAGGCGTGGATCGAGCGTTTTCGAGAGAGCAGCGCCTCGCAGCATCATTACTGCGCCTACACTTTCACGACTGCTTTGTCAAC
GTTGGATCACGAGTTCCACACTTGAAACTCGGCACG
GGTTAAGTCACTGTTCTCATCTCGGTTGCTCATGTGCAGGGCTGCGATGCTTCGATTCTCCTGGATGACACTTCCACCTTCACTGGCGAGAAGGCAGCCGGGCCAAACCTCAACTCGGCG
AGAGGCTTCGATGTTATCGACGATATCAAGTCGGAGCTCGAGAATCAGTGTCCAGGCATTGTCTCGTGCGCTGACATTCTAGCTCTCGTTGCCAGGGACTCCGTCGCTGTG
GTAAAGTTC
ATACAAACTTAGTCGCTATCGATCAACTTTGTTCTTTCAGTCCGCTGGACCATCGTGGGATGTTCTTCTGGGCCGCCGAGATAGTTTTCGAGCTAGCCAAGCCGATGCCAATCGCTTCAT
TCCATCGCCCGCGTCGGACGTTCCAGCGTTGGTCTCGGCATTTCAAGCAGTGGGTCTCTCAGCATCGGACATGATAGTTCTTTCAG
GTACTGCCAGCCAACTTCGATTCTCCCACGCAAA
AAAAAAGGATTTTTCTCGTTTCTAGGTGCTCATACTATTGGAGCTGCTCGCTGCGGCACCCTGACTCCACGTCTCTACAACCAAAGTGGCACCGGACAGCCCGACTCCATCGGCGATCCC
GATTTTCTGGCCTCGCTCCAGCGCTTGTGTCCACCGGGTGGCAATCCGGGGACTCTCTCCCGCCTCGACGTGAGATCTCCGCAGGAATTCGACAACTCCTACTACCAGAATTTGCTGCAA
GGCCGCGGAGTGCTCCACTCGGATCAAATCCTCTTCTCCGGCGGTGGCTCGTCGGCACAGGCAGTCCAAGACTTGAGCAGCGATGAAAATCTCTTCTTTGGGAACTTTGCGGCGTCCATG
GTGAGACTGGGGAGCATCGCTCCTCTCACTGGCCCGGATGGAGAGATTAGAACGAACTGCCGCTTTACAAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTTTGTCTGGCTTGTGGTGGCTCTACTGCTATCTCTTGTTATCTCTTTGGTTGATTCTCAGCTCACCACCAGCTTCTACGATCAAAGTTGTCCGCAGGTCTTCTCCATCGTGAGG
CAAGGCGTGGATCGAGCGTTTTCGAGAGAGCAGCGCCTCGCAGCATCATTACTGCGCCTACACTTTCACGACTGCTTTGTCAAC
GGCTGCGATGCTTCGATTCTCCTGGATGACACTTCC
ACCTTCACTGGCGAGAAGGCAGCCGGGCCAAACCTCAACTCGGCGAGAGGCTTCGATGTTATCGACGATATCAAGTCGGAGCTCGAGAATCAGTGTCCAGGCATTGTCTCGTGCGCTGAC
ATTCTAGCTCTCGTTGCCAGGGACTCCGTCGCTGTG
TCCGCTGGACCATCGTGGGATGTTCTTCTGGGCCGCCGAGATAGTTTTCGAGCTAGCCAAGCCGATGCCAATCGCTTCATTCCA
TCGCCCGCGTCGGACGTTCCAGCGTTGGTCTCGGCATTTCAAGCAGTGGGTCTCTCAGCATCGGACATGATAGTTCTTTCAG
GTGCTCATACTATTGGAGCTGCTCGCTGCGGCACCCTG
ACTCCACGTCTCTACAACCAAAGTGGCACCGGACAGCCCGACTCCATCGGCGATCCCGATTTTCTGGCCTCGCTCCAGCGCTTGTGTCCACCGGGTGGCAATCCGGGGACTCTCTCCCGC
CTCGACGTGAGATCTCCGCAGGAATTCGACAACTCCTACTACCAGAATTTGCTGCAAGGCCGCGGAGTGCTCCACTCGGATCAAATCCTCTTCTCCGGCGGTGGCTCGTCGGCACAGGCA
GTCCAAGACTTGAGCAGCGATGAAAATCTCTTCTTTGGGAACTTTGCGGCGTCCATGGTGAGACTGGGGAGCATCGCTCCTCTCACTGGCCCGGATGGAGAGATTAGAACGAACTGCCGC
TTTACAAACTCTTGA

Retrieve as FASTA