Entry information : SmPrx33-2_131 (SmPrx33b_131)
Entry ID 7036
Creation 2009-10-13 (Christophe Dunand)
Last sequence changes 2009-10-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx33-2_131 (SmPrx33b_131)
Name (synonym) SmPrx33-2_131 (SmPrx33b_131)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx33-2_131
start..stop
S start..stop
SmPrx33-1_84 705 0 1..345 1..345
CmichPrx01 396 2e-138 42..342 60..361
SmPrx37-1_2 375 2e-130 46..342 43..340
SmPrx37-2_44 375 2e-130 46..342 45..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 339048..339308 261 N° 2 338785..338976 192 N° 3 338143..338727 585  
complement(join(338143..338727,338785..338976,339048..339308))


exon

Literature and cross-references SmPrx33-2_131 (SmPrx33b_131)
DNA ref. Phytozome 12:   scaffold_131 (339308..338143)
mRNA ref. JGI transcript:   430498
Protein sequence: SmPrx33-2_131 (SmPrx33b_131)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345
PWM (Da):   %s   37252.28  
PI (pH):   %s   8.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIPRPGVGGFPFPAGRGFPFPGGRPFPFPGGATSAEMGVAVLRPGFYKEKCPAAESIVKKVLQQAVEKDSRTAANILRLQFHDCFVLGCDASILLDDTHTFKGEKTANPNRNSARGFEVIDEIKAALEKECEGVVSCADVLAIAARDSVVLTGGPSWEVHLGRRDSLTASRSLANRDIPPPNSTLPQLIAAFAKKGLSIVDLVALTGSHTIGVSRCASFRQRLYNFAGTRRPDPSIDPALLRSLEHICPPKGNAQETTPLDIVTPTKFDNHFFVDLELHKGVLTSDQVLFAPYAPTSALVTAFAYDQAKFFQEFVASMVRMAAIKPLLGSEGQIRKECRFVNHKY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST. Transcript prediction with a very long PS (=> 5' intron? need to be controled)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCGAGGCCTGGCGTGGGAGGCTTTCCATTCCCAGCAGGACGGGGTTTTCCATTCCCAGGAGGACGACCATTTCCATTTCCCGGTGGTGCTACTTCTGCGGAGATGGGAGTTGCT
GTGTTGCGGCCTGGCTTCTACAAGGAGAAGTGCCCCGCTGCCGAGTCTATCGTGAAGAAAGTCTTGCAGCAGGCTGTGGAAAAGGATTCTAGAACTGCTGCAAACATTCTCAGGCTTCAG
TTCCACGATTGTTTCGTTCTG
GTAAGTTGTTGCATTCTTTTTTCTTTGTTTTTCTTTGTTTTTGATGAGAATAAGATGTGAATTTCTTGCAGGGATGTGATGCTTCCATACTTCTGGACG
ATACGCATACTTTCAAAGGAGAAAAGACCGCCAATCCCAACAGGAACTCGGCTCGTGGCTTCGAAGTCATTGACGAGATCAAGGCTGCTCTGGAGAAGGAATGCGAGGGTGTTGTTTCTT
GTGCCGACGTTCTCGCCATTGCTGCACGGGACTCGGTCGTCCTG
GTACGTACTTCGATACTAGACTTTGATCTCACTTCTTTTCTGTGTGGCATGAATCAGACTGGAGGCCCGTCGTGGG
AAGTTCATCTTGGTCGTCGAGACAGCCTGACTGCGAGCCGCAGCCTGGCCAACAGAGACATCCCGCCTCCCAACTCGACGCTTCCGCAGCTCATCGCCGCGTTTGCCAAGAAGGGCCTGT
CCATCGTGGACTTGGTAGCACTGACGGGCTCTCACACCATCGGCGTGTCACGCTGCGCCAGCTTCCGGCAGCGCCTCTACAACTTTGCGGGAACTCGTCGGCCAGATCCGAGCATCGACC
CGGCGCTCCTCCGCAGCCTCGAGCACATTTGTCCTCCCAAAGGCAACGCGCAGGAGACGACGCCTCTGGACATCGTCACTCCCACCAAGTTTGACAATCACTTCTTCGTCGATCTGGAGC
TTCACAAGGGTGTTCTTACGTCGGACCAGGTGCTGTTTGCGCCGTATGCTCCCACCAGCGCACTGGTTACGGCATTTGCCTACGACCAGGCAAAGTTCTTCCAGGAGTTTGTAGCGTCCA
TGGTGAGGATGGCTGCCATCAAGCCGCTGCTGGGATCGGAGGGCCAGATCAGGAAGGAGTGCCGGTTCGTCAATCACAAGTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCGAGGCCTGGCGTGGGAGGCTTTCCATTCCCAGCAGGACGGGGTTTTCCATTCCCAGGAGGACGACCATTTCCATTTCCCGGTGGTGCTACTTCTGCGGAGATGGGAGTTGCT
GTGTTGCGGCCTGGCTTCTACAAGGAGAAGTGCCCCGCTGCCGAGTCTATCGTGAAGAAAGTCTTGCAGCAGGCTGTGGAAAAGGATTCTAGAACTGCTGCAAACATTCTCAGGCTTCAG
TTCCACGATTGTTTCGTTCTG
GGATGTGATGCTTCCATACTTCTGGACGATACGCATACTTTCAAAGGAGAAAAGACCGCCAATCCCAACAGGAACTCGGCTCGTGGCTTCGAAGTCATT
GACGAGATCAAGGCTGCTCTGGAGAAGGAATGCGAGGGTGTTGTTTCTTGTGCCGACGTTCTCGCCATTGCTGCACGGGACTCGGTCGTCCTG
ACTGGAGGCCCGTCGTGGGAAGTTCAT
CTTGGTCGTCGAGACAGCCTGACTGCGAGCCGCAGCCTGGCCAACAGAGACATCCCGCCTCCCAACTCGACGCTTCCGCAGCTCATCGCCGCGTTTGCCAAGAAGGGCCTGTCCATCGTG
GACTTGGTAGCACTGACGGGCTCTCACACCATCGGCGTGTCACGCTGCGCCAGCTTCCGGCAGCGCCTCTACAACTTTGCGGGAACTCGTCGGCCAGATCCGAGCATCGACCCGGCGCTC
CTCCGCAGCCTCGAGCACATTTGTCCTCCCAAAGGCAACGCGCAGGAGACGACGCCTCTGGACATCGTCACTCCCACCAAGTTTGACAATCACTTCTTCGTCGATCTGGAGCTTCACAAG
GGTGTTCTTACGTCGGACCAGGTGCTGTTTGCGCCGTATGCTCCCACCAGCGCACTGGTTACGGCATTTGCCTACGACCAGGCAAAGTTCTTCCAGGAGTTTGTAGCGTCCATGGTGAGG
ATGGCTGCCATCAAGCCGCTGCTGGGATCGGAGGGCCAGATCAGGAAGGAGTGCCGGTTCGTCAATCACAAGTACTGA

Retrieve as FASTA